KEGG   Theobroma cacao (cacao): TCM_033838Help
Entry
TCM_033838        CDS       T02994                                 

Definition
Alpha-amylase-like
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
tcc  Theobroma cacao (cacao)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TCM_033838
Enzymes [BR:tcc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     TCM_033838
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 449 aa AA seqDB search
MLTSLCFISLFLSVFPSLVSPALLFQGFNWESCNKAGGWYNFLKNSVSDIANAGVTHVWL
PPPSQSVGPQELRPCILFENCPVLAIFDCIDDYVHILKELIFHPGYLPGRLYDLDASKYG
SQAELKSLIDAFHQKGVKCVADIVINHRTAERKDGRGIYCIFEGGTPDDRLDWGPSFICG
DDKEYSDGTGNPDTGLCYQPAPDIDHLNPRVQKELSDWMNWLKTEIGFDGWRFDFVRGYA
PSITKIYMDQTSPDFAVGEKWEDFSLGQEDSHRGALKDWVEAAGGVVTAFDFTTKGVLNA
AVQGELWRLKDSNGKPPGMIGLLPQNAATFVDNHDTGSTQNQWPFPSDKVMQGYAYILTH
PGVPSIFYDHFFDWGLKDEISKLVAIRNRNGISTSSTVNILASDSDLYMASIDEKIIMKI
GPKMDLGNLVPSNYQLATSGNDYAVWEKK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgttgacttcactttgcttcatctctctcttcctctctgtctttccctctttggtatcc
cctgccttactgttccagggtttcaactgggaatcatgcaacaaggcaggtggatggtac
aactttctcaagaactccgtctctgatattgctaacgctggtgttacacatgtttggctc
cctccaccatcgcagtccgttgggccccaggaattgaggccttgtattttgtttgaaaat
tgtcctgtcctagccatctttgactgtattgatgattatgttcacatcctcaaggagctc
atttttcatccaggatacctgccaggaaggctgtatgatcttgacgcatcaaagtatgga
tctcaggcagaattgaagtcattgattgatgctttccatcaaaaaggagtcaagtgtgtt
gctgacatagtaataaaccatagaacagctgagaggaaagatggaagaggtatatattgt
atttttgaaggtggaaccccagatgaccgtctagattgggggccatccttcatttgtggc
gatgataaggagtattcggatggcacaggcaatcctgacactggactgtgttaccagcct
gctcctgacattgatcatctcaatccaagggtacaaaaggaattatcggattggatgaat
tggttaaagactgaaattggatttgatggatggcgttttgattttgtaagaggctatgcc
ccaagcattaccaaaatctacatggatcaaacttcaccagatttcgctgttggggagaaa
tgggaagacttttctcttggacaagaagattcacatcgcggtgcactaaaagattgggtt
gaagcggccggtggggttgttacagcatttgatttcactacaaaaggggttctcaatgct
gccgtgcaaggggaattatggcggttgaaggactcgaatggtaaacctccaggaatgatt
ggacttttacctcaaaatgctgctactttcgtcgacaatcatgacaccggttccacccaa
aatcaatggcccttcccatctgacaaagtcatgcagggatatgcttatattctcacccat
cctggcgtcccctccattttttacgaccacttctttgattggggtttgaaggatgagatt
agtaaactggtggcgatcaggaacaggaatgggatcagtacctcaagcacggttaatatt
ctggcttctgattccgacctttacatggcatctattgatgagaaaattattatgaagatt
ggaccaaagatggatcttggaaaccttgttccttctaactaccagcttgctacctcaggg
aacgactatgcagtatgggagaagaagtga

DBGET integrated database retrieval system