KEGG   Theobroma cacao (cacao): TCM_034079Help
Entry
TCM_034079        CDS       T02994                                 

Definition
Dihydroflavonol-4-reductase
Orthology
K13082  
bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [EC:1.1.1.219 1.1.1.234]
Organism
tcc  Theobroma cacao (cacao)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:tcc00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    TCM_034079
Enzymes [BR:tcc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     TCM_034079
    1.1.1.234  flavanone 4-reductase
     TCM_034079
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 279 aa AA seqDB search
MGSDGEMVCMTGASLDHGSSCCSWNAVMSQLEEGEEGSFDDAIQGCTVVFHVATPMDFES
KDPENDVIKPTINGVLSIMKACAKAETVRRLVFTSSAGTIDVAEHQKPFYDETCWSGLAF
IQAKKMTGWMYVVSKTMAEQAAWKFAKENNIDFVSIIPPLVVGPFIMQSMPPSLITALSP
ITGTGFSVIFHKGRYICASHHATILDIAKMLREKYPEYNVPTEFKDVDESLKSVEFSSKK
LTDLGFEFKCSLEDMFTGAVETCREKGLLPLSNEKIDIK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgggatcggacggcgagatggtgtgcatgacaggcgcgtcattggatcatggctcgtca
tgctgctcttggaacgcagttatgtcacaacttgaagaaggcgaagagggtagctttgat
gatgcaattcaaggttgcacggttgtgttccatgtcgccacacccatggatttcgagtcc
aaggaccctgagaatgacgtcataaaaccaacaatcaatggggtgttaagcatcatgaaa
gcatgtgctaaagccgaaactgttagaaggttggtgttcacatcatctgcaggaactatt
gatgttgcagagcaccaaaagcccttctatgatgaaacctgttggagcggtcttgcattt
atccaggccaagaaaatgactggttggatgtacgttgtctccaagaccatggcagagcaa
gccgcctggaagtttgctaaagaaaacaacatcgattttgtcagcataataccaccttta
gttgttggtccatttattatgcagtcgatgccgccaagccttataactgcactttctccc
atcactggtacaggcttctctgtgattttccacaagggccgctacatttgcgcctctcac
catgctaccattctagatattgcgaagatgcttagagaaaaataccctgaatacaatgtt
cccaccgagttcaaggatgtggatgagagcctgaagagtgtggaattctcttcaaaaaag
ctcacggacttgggattcgagtttaagtgcagcttggaagacatgttcacaggagctgtt
gaaacatgccgagaaaagggtctgcttcctctttccaatgagaagatcgatataaagtaa

DBGET integrated database retrieval system