KEGG   Theobroma cacao (cacao): TCM_034794Help
Entry
TCM_034794        CDS       T02994                                 

Definition
Calcineurin-like metallo-phosphoesterase superfamily protein isoform 1
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
tcc  Theobroma cacao (cacao)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:tcc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TCM_034794
Enzymes [BR:tcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     TCM_034794
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 446 aa AA seqDB search
MERLLAVVVGVLQVLIASAGSYADNHLLSRIAFGSCANQSAPQPIWDAINKFDPQVFIWL
GDNIYGDIRQPFKILGKERTIGPWKNVRRFVPSSHSQMLSRYNMAKNIPGYSRLRANAKV
IGTWDDHDYGLNDAGKEFSEKITNQRLLLDFLDEPQDSPRRKQAGVYTSYTLGPPGKQVK
IILLDTRYHRDPISSDGSVLGESQWSWLGKELRGPPSTITIIGSSIQVISNLSATTGPLF
YMESWGRFPKERNRLFKLIADSKRDGVFFISGDVHFGEITRYDCGAGYPLYDITSSGLTQ
AIEKVLPSPLHFIVRFLAWFTPSTMRAMSQTCRYRSCTYGEPNFGAIEIDWDAFPVTLKI
QVRDINGLPVTGVNISLSELQAQNSTIKVRQDRRHCSLEVMLPWIVKYRLAILVYSVLAL
LLLALVGLIYAATIVCRMCLSKCKID
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggagaggttactagcagtggtagtaggagttttgcaggtgttgatagcaagcgccggt
tcatacgccgataatcacttgctatctcgcattgctttcggatcttgtgccaaccaaagc
gctcctcagcccatctgggacgccatcaacaagtttgatccccaagtattcatatggctt
ggtgacaacatatatggagacattagacagcctttcaagattctgggaaaggaaaggaca
attggtccctggaagaatgttcgcaggttcgttccttcctctcactcccaaatgctttca
aggtacaatatggctaagaacattcccggttattctcgtcttcgcgccaatgctaaggtc
attggtacttgggatgatcatgattatggactcaatgatgctggcaaagaattttctgag
aaaattactaatcagaggcttctccttgatttcttagatgaaccccaagatagtcccagg
cgcaagcaggctggtgtttacacatcttacacattaggccctccaggtaaacaagtcaag
attatcctattagatactcgatatcacagagatcctatatctagtgatggaagtgtcttg
ggggaatcacaatggtcttggttagggaaagagttgaggggtccaccatcaaccattacc
ataattggctcttccattcaggttatatcaaatctttcagctacaactggccccttgttt
tatatggagtcttggggacgttttcccaaggagaggaatcgcctttttaagttgatagca
gatagtaagagagatggagtcttcttcataagtggagatgttcattttggagaaattaca
cgatatgactgtggagctggatatcccttgtatgacattacctcaagtgggctaacccaa
gctattgagaaggtgctcccatcaccgttgcatttcattgtgagatttttggcatggttt
acacctagtacaatgagagctatgagccaaacttgcagatataggtcatgcacatatggt
gaaccaaactttggagccattgagatagattgggatgcatttccagtgaccttgaaaatt
caagtccgcgatataaatggacttcctgtgactggtgtaaatatttcattatcagaattg
caagcacagaattctacaattaaagtaagacaagatcggaggcactgctctctggaagtg
atgttaccatggattgttaaatatcgcttggctattctggtctattctgttttagctttg
ttgcttcttgctttggtaggactgatttatgcagcaacaatagtctgccggatgtgcctc
agcaaatgcaagattgattga

DBGET integrated database retrieval system