KEGG   Theobroma cacao (cacao): TCM_036279Help
Entry
TCM_036279        CDS       T02994                                 

Definition
Beta-glucosidase, GBA2 type family protein isoform 2
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
tcc  Theobroma cacao (cacao)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    TCM_036279
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TCM_036279
Enzymes [BR:tcc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     TCM_036279
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 948 aa AA seqDB search
MENGLKETVENDKASNGTLLEADSGKPPSLTWQRQLNSIRKPPTAFGLGFNEIIHMAQIG
FRLWRYTKEEEAKGRASIFDIFRKHLVTSDHGVPLGGIGAGSIGRGYRGEFQRFKLFPKV
CEEGPILANQFSAIVSRPNGNKCSTVLCARSPEVPKESTGLGIESWDWNLKGEKCTYHAL
FPRSWTIYEGQPDPELRISCCQISPFIPHNYKESSFPVSVFTFTLSNTGSTSADVTLLFT
WTNSVGGNSGFSGDHFNLKMKTEDGVRGVLLHHKTANGKPPLTFAIAAKETSEVHVSECP
CFLISGNFQGMSAKDMWHEIKKHGSFDNLDYEESSPSEPGSSIGAAVAASVTVPSDSVRR
VTFSLAWDCPEVRFDDKTYHKRYTKYYGTLGDAAANIAHDSIFEHSNWESQIESWQRPIL
EDKRLPDWYPVILFNELYYLNAGGTIWTDGSPPMQSLVSIGEKKFSLDKSRSHLDNTIDT
ANQDGIAIDILERMTSVLEKAHIPLMSNAAFGTRLLQDGEENIGQFLYLEGSEYLMWNTY
DVHFYSSFALLMLFPKLELSIQRDFAAAVMIHDPSKMEIMSDGKWVPRKVLGAVPHDIGL
NDPWFEVNAYNLFNTDNWKDLNSKFVLQIYRDIVATGDKNFAQAVWPSVYTAMAFMEQFD
SDGDGMIENQGFPDQTYDAWSVTGVSAYSGGLWVAALQAASSIACQVGDDVSAAYFHVKY
QKAKSVYGTLWNGSYFNYDNTGSSSSRCILADQLAGQWYARASGLMPIADDDKVRSALQT
IYDFNVLKVKGGTRGAVNGMLPDGRVDMSALQSREVWAGVTYAVAATMIQEGMVETAFKT
AAGAYEAAWSQQGLGYSFQTPEAWNTDEQFRSLCYMRPLAVWAMQWALTKPKLFTEEMKH
GVIDDFLYHKQHLGYSKVAHLLKLPSKEETSKTFLQSVTEFICRRVPI
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atggagaatggcttgaaagagactgttgaaaatgataaggctagcaacggtactttgctt
gaggctgattcggggaaacctccttccctcacatggcaacggcaattgaatagcattcga
aaaccccctactgcttttggcctaggtttcaatgagataattcatatggcacaaataggt
tttcggctgtggcgttacaccaaagaagaagaagcaaaaggacgagcatctatatttgat
attttcagaaagcaccttgttacatctgatcatggcgttcctttaggtggtataggggca
ggaagcattggaagaggttacagaggtgaatttcaacgctttaaactatttcccaaagta
tgtgaagagggtccaatcttggcaaatcagttctctgctattgtatcacgtccaaatgga
aacaaatgttcaactgtactatgtgcaagaagtccagaggtgccaaaagaaagtacaggt
ctgggcattgaatcttgggattggaacttgaaaggggagaagtgtacataccatgctttg
tttccaaggtcatggactatttatgagggtcaacctgatccagagcttagaatcagttgt
tgtcaaatttcgccttttattcctcacaattacaaagagagcagttttcctgtatcagtg
tttacgttcacgctctctaatactggaagtacctctgctgatgtcaccttgctttttaca
tggactaattcggtgggagggaactctggattttctggtgatcacttcaacttaaagatg
aagacagaagatggagttcgtggagtacttctacaccacaaaacagccaatgggaaacct
ccacttacttttgccattgcagcaaaggaaactagtgaagtacatgtctcagagtgccct
tgcttcttgatatctggaaattttcaaggcatgagtgccaaagatatgtggcatgaaatt
aaaaagcatgggtcatttgacaaccttgattatgaagaatcttcaccttcagaaccagga
tcatccattggagcagctgttgcagcctctgtgactgttccttctgattctgttcgtaga
gtcacattctcacttgcatgggactgtccagaagtaagatttgatgacaagacataccac
aagcgctatacgaaatattatggcactttaggggatgcagcagcaaatattgcacatgat
tctatttttgagcattctaactgggaatcccagatagaatcatggcaaagaccaattctt
gaagacaaaaggcttccagactggtatcctgtcattctcttcaatgagctctactacctt
aatgcaggggggacaatatggacagatggatcacctccaatgcaaagtttagtatccatc
ggagagaagaagttttctcttgacaagtccagatcacatttggataatacaattgacact
gctaatcaagatggtatagctattgacatcctagagaggatgacatctgtactcgagaaa
gcacatattcctctaatgtcaaatgctgcttttggaacccgtttgctccaggatggagaa
gaaaacattggtcagttcctctaccttgaagggagtgagtacctcatgtggaacacttat
gatgttcatttctactcctccttcgcactactcatgctattcccaaaacttgaactgagc
atccagagagactttgcagcagcagttatgatacatgatccaagcaagatggaaattatg
agtgatgggaaatgggttccaagaaaggttcttggtgctgttccacatgatattgggctt
aatgacccttggtttgaagtaaatgcttataatctatttaatacagataattggaaagac
ctgaattctaagtttgttctccaaatctatagggatattgttgctactggagacaaaaat
tttgcacaggctgtttggccttcagtttatactgcaatggcttttatggaacaatttgat
agtgatggagatgggatgattgagaatcaaggtttcccagatcaaacatatgatgcatgg
tctgttactggtgtgagtgcttatagtggggggctctgggtggcagccctccaagctgct
tcatctattgcttgccaagtaggtgatgatgtgtctgctgcctactttcatgtgaagtat
caaaaggcaaaatctgtatatggcaccttgtggaatggctcctacttcaactatgacaac
acagggagtagttccagcagatgtattctagctgatcaactggctggacaatggtatgct
agagcaagtggtctcatgccaattgcagatgatgacaaagtgagaagtgcacttcaaacg
atatatgatttcaatgtcttaaaggtgaaaggaggaacacgtggtgccgtaaatgggatg
cttccagatggaagagttgatatgtcagcactacaatcaagggaagtttgggctggagtt
acatatgctgttgctgctactatgattcaagaggggatggtcgaaacagcatttaaaaca
gcagccggtgcgtatgaagctgcttggtcacagcaaggtctcgggtactcttttcagacc
ccagaagcctggaacacagatgagcagttcagatccctctgttacatgagacctttagca
gtatgggcaatgcaatgggctttgacaaagccaaaactcttcacagaggagatgaaacat
ggagtgattgatgactttttataccataagcagcatctaggatattcaaaagtggctcac
ctcttaaagctgcctagtaaggaggaaacctctaaaaccttcctacagtctgtcactgag
ttcatttgcagaagagtaccaatttga

DBGET integrated database retrieval system