KEGG   Theobroma cacao (cacao): TCM_041657Help
Entry
TCM_041657        CDS       T02994                                 

Definition
JOSEPHIN-like protein, putative
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
tcc  Theobroma cacao (cacao)
Brite
Enzymes [BR:tcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TCM_041657
Peptidases [BR:tcc01002]
 Cysteine Peptidases
  Family C86
   TCM_041657
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 322 aa AA seqDB search
MASEQNQIYHERQRLQYCLLHSLNNLFQQKDAFTRASLNSVAEKLVLDDPNKEIWTPFSL
VFKPHHNSITGNYDINVLIAALEGKGKTVIWHDRRNGASAIDLNDEILMGIVINVPVRRY
AGLWKSRHWIALRNIDGVWYNLDSDLDAPQCFKDSGEVKDFLDYIITHDGQLLLVKNDRQ
VCKRKESILQIESLVRKVTQGSNKVSRKKGNNKVNASAMQKSDNKAAGNRGVTRSCGFML
CKRSKFSPVRFLKHLGGKVAKGLHVVSMRIRPSPKVSSSSGRSKPFVTPVDSHRSAAIED
CIEFINSSASLPRSNSVSANSH
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcgagcagaaccaaatctatcacgaaaggcagagattacaatattgcctctta
cattcccttaacaatctcttccagcaaaaagatgcatttactcgagctagcttgaattcc
gttgctgaaaaactcgttcttgatgacccaaacaaggaaatttggacacccttttcatta
gtcttcaagcctcaccataattcaattactggaaactatgacataaatgttttgattgct
gcacttgaagggaaagggaagactgtgatttggcatgatcgtcgaaatggagcatcagct
attgatcttaatgatgaaattttgatgggaattgtgattaatgttccggttagacggtat
gctgggctctggaaaagtaggcattggattgcattgagaaatattgatggggtttggtat
aatttggacagtgatcttgatgcacctcagtgttttaaggattctggagaagttaaggat
ttcttggattatatcattactcatgatggacagcttttgcttgtaaaaaatgatagacag
gtatgtaaaagaaaagaaagcatactacagatagaatcccttgtaagaaaagttacccaa
gggagcaacaaagtgagtaggaaaaagggaaacaacaaggtaaatgcttctgctatgcag
aagtccgataacaaggctgctgggaacaggggagtcaccaggagttgtggcttcatgctg
tgtaaaagatctaagttttcaccggtaagatttctcaagcatctcggtgggaaagtggca
aaaggtttgcatgtggtgtcaatgagaattaggccttctcctaaggtttcttcttcatca
ggaagatcaaagccatttgtaactcctgttgattctcataggagtgctgccatcgaggac
tgcatcgaatttatcaactcttctgcttctttgcctagatcaaattctgtttctgctaat
tctcattga

  All links  
No link information was found.   
DBGET integrated database retrieval system