KEGG   Theobroma cacao (cacao): TCM_044748Help
Entry
TCM_044748        CDS       T02994                                 

Definition
Kinase superfamily protein isoform 1
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
tcc  Theobroma cacao (cacao)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:tcc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    TCM_044748
Enzymes [BR:tcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     TCM_044748
    2.7.1.82  ethanolamine kinase
     TCM_044748
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 341 aa AA seqDB search
MGASTNKENRLPREVKDALQLLASDWDDVVDSKALQVIPLKGAMTNQVFQIKWPTRTDEV
SRKVLVRIYGEGVEVFFDRDNEIRTFEFMSKHRQGPRLLGRFPNGRIEEFIRARTLSASD
LRDPNVSALIAAKLREFHELDMPGPKKVWLWDRLQNWLNAAKRVCPLEEAKAFRLEVIEE
EISMLEKKLSGCHQHIGFCHNDLQYGNIMIDEETKSITIIDYEYASYNPVAYDIANHFCE
MAADYHTEMPHIMDYSKYPGWGERLRFLRIYLHSSGKEPRDTEVDQLLKDVEKFTLASHL
TWGLWGIISEHVNEIDFDYKEYAKQRFQQYWMQRPELLGSS
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcctcaactaataaagagaacaggttgccacgggaagtaaaggatgctctacaa
ttgttggcttctgattgggatgatgtggtggactcaaaagctttgcaggtgatccctctt
aaaggtgcgatgaccaatcaggtcttccaaataaaatggccaaccaggacagatgaagtg
tcacgaaaggttttagttaggatttatggtgagggtgtggaggtgttttttgaccgggac
aatgagatccgtacttttgagtttatgtcgaaacataggcaaggacctcgtttgcttgga
cggttcccaaatgggcgaattgaagagttcatccgtgcacggacactatctgcatctgat
ttgcgtgatccaaatgtatcagctctaatagcagctaaattgagggagttccatgaacta
gacatgcctggtccaaagaaagtttggctatgggatagattgcaaaattggctaaatgcg
gccaagagagtctgccctctggaagaagctaaagcctttcgcttggaagttattgaggag
gaaatctcaatgttagaaaagaaactctcagggtgccatcaacacataggtttctgccac
aatgatttacaatatggtaacattatgatcgacgaagagactaaatcaataaccattatt
gattatgagtatgcaagttacaatcctgttgcctatgatattgcaaaccacttttgtgag
atggctgctgactatcatacagaaatgccccatattatggattatagtaaatatccaggt
tggggagagcgcttaagatttctgcgtatatacctgcactcttcaggtaaggaacccaga
gacactgaagtggaccagctgcttaaagatgtcgagaagtttactctagcaagtcatctc
acttggggcttatggggaataatatcggaacatgtgaatgaaattgactttgactacaag
gagtatgctaagcagaggtttcagcagtattggatgcagaggcctgagctgttgggctct
tcttga

DBGET integrated database retrieval system