KEGG   Thermobacillus composti: Theco_0009Help
Entry
Theco_0009        CDS       T02394                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tco  Thermobacillus composti
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Theco_0009
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Theco_0009
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Theco_0009
Enzymes [BR:tco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Theco_0009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10369..11760
Genome map
AA seq 463 aa AA seqDB search
MKYISTRGGVAPIGFTDAILMGLADDGGLLVPERLPRLSDDALKAWRKLSYSELALELLA
LFMEEDIPREELERLVNDSYATFRDPHVTPVVKLRDDLHVLELFHGPTFAFKDVALQFLG
NLYAYVSRKTGSVIHILGATSGDTGASAIEGVRGKEGIKICILHPHGKVSRVQELQMTTV
QDDNVLNLAVEGTFDDCQRIIKELFADVPFKRQYHLRAINSINIARILAQTVYYFYAYFR
LAEQGHAGPVNFSVPTGNFGDIFAGYIAKRMGLPVGKLVLATNENDILARFVASGVYQPG
EFRGTYSPSMDIQVASNFERYLYYLYDGDAGTVATLMERFRSEGRIEVPQDVLLKVREDF
AAYSVSNEECLDTIARYYESYGYLLDPHTACGVAAADKRSDEGEVTISLSTAHPAKFDEA
IRLRNISQVYPEPIQALFGKPRRVTVVGNANEQVKEQLEAFFG
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatatcagcacccggggcggggtcgccccgatcggattcaccgacgccatcctg
atggggctcgcggacgacggcgggctgctcgtgccggagcggctgccgcggctgtcggac
gacgcgctcaaggcgtggcggaagctgtcctactccgagctggcgctggagcttctggcg
ctgttcatggaggaagacatcccgcgagaagagctggagcggctcgtcaatgacagctac
gcgacgttccgcgatccgcacgtcacgccggtcgtgaaattgcgcgacgatctgcacgtg
ctggagctgttccacggcccgacgttcgccttcaaggacgtcgcgctgcagttcctcggc
aatctgtacgcttacgtctcgcggaagaccggttcggtcatccatatcctcggcgcgacg
tccggcgacaccggggcgtcggccattgaaggcgtgcgcggcaaggaaggcatcaagatc
tgcatcctccacccgcacggcaaggtcagccgggtgcaggaactgcaaatgacgacggtg
caggacgacaacgtgctgaacctcgccgtcgaaggtacgttcgacgactgccagcgcatc
atcaaggaactgttcgcggacgttccgttcaagcggcagtatcatctgcgcgccatcaac
tcgatcaacatcgcccgcatcctcgcgcagacggtttactatttctacgcgtacttccgt
ctggcggaacaggggcatgccggcccggtcaacttcagcgtgccgaccggcaacttcggc
gacatcttcgccggctacatcgcgaagcggatggggctgccggtcggcaagctcgtgctc
gcgacgaatgagaacgacattctcgcccgcttcgtcgcaagcggcgtctatcagcccggc
gaattccgcggcacgtacagcccgtccatggatatccaggtggcgagcaacttcgagcgc
tatctgtactacctgtatgacggcgatgccggcacggtcgcgacgctgatggaacggttc
aggtccgaaggccggatcgaagtgccgcaggacgtgctgcttaaagtgcgggaagacttc
gccgcttacagcgtgtcgaacgaggaatgtctcgacacgatcgcccgctattacgaatcg
tacggctatctgctcgatccgcacaccgcctgcggcgtcgcggccgcggacaagcggtcg
gacgaaggcgaggtcacgatctcgctgtccaccgcccatcccgccaagttcgacgaggcg
atccggctgcggaacatctcgcaagtgtatcccgagccgatccaggcgctgttcggcaag
ccgcgccgcgtcacggtcgtcggcaatgcgaacgaacaggtgaaggaacagctcgaagcg
ttcttcggctga

DBGET integrated database retrieval system