KEGG   Thermobacillus composti: Theco_0011Help
Entry
Theco_0011        CDS       T02394                                 

Definition
beta-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
tco  Thermobacillus composti
Brite
Enzymes [BR:tco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Theco_0011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(12792..17210)
Genome map
AA seq 1472 aa AA seqDB search
MRGKLRKHVASLLALLLLIPGGMAAPASAVDDPVVVYHETFEHGIGKTAQSGGASLQHAT
GVYFDGNTDGGALYVTNRKNEWDAADYYVSSIPLQTGITYTVTASVYADPADLNGLDKLT
IVAAVVTKNDQYRQQKSVELEPGKPATLTETFTVEDHDKSFRIQTDAAGKATPFYIGEIK
FVLTGTGGPDEPDGKVVLSQSFEDGDYTGWSRKSWGGQGTLEVSSDVASDGSKSLKFTNR
ESADSQPLLNATGVMKSGRTYDVSLKVRLGAGSGQFHIASKINSPLLDNQYPWLVGNQDV
TANDWTTFAAKGVEIPADTSEVLLWIESAESNTLTSDIYIDEVLIVDVTSGGEDPGDVDT
SGIFDDFESGIGNWVRRFGAGGIEVTQEDNHTEGGKHSLKTTASAQYDGPLLDVHGKMAR
GHQYELSAWVKMARGEEPTVLRISIQYGESGFANVSPNVTVTDGEWVKLSGRYTQSVTPG
DHLNAYVEVANDYGGPRTFLIDDFELKYIGPVAGPNPDFTLPAIKDIYKDQFLIGNIMNP
GNFDDEIRSKMLKHHYNLLTAENAMKPEYAYKPGTREFDLTDEIALAEQAIANGFKVHGH
VLVWHSQSPDWLHTQVDANGTPLRDANGNILYLDKEEALNNLRTHIRTVVKTTGDRVISW
DVVNEAMNDNPPNPADWRDSLRRSGWYYAIGPDYIYEAYKTAREVIDENGWDIELYYNDY
NDDNQNKATAIANMVKELNERYAAETNSDKKLIDGIGMQSHYNLNTNPDNVRASIERIIG
LGLKVGITELDVMAGTNGTITEDQAIRQGWLYAQLFQLYKEYADHITRVTFWGVDDGTSW
RSENSPLLFDGRYQAKPAYYAVMDPAKFIEDHPPAEKEYQEGTAAYGTPAVDGTEDAVWS
RAEELPIARFQTAHNGATGTARVLWDDRNLYVLIKVQDTALDQTSDLPYEQDSVEVFLDE
TNSKAPSYGPGIGQYRVNYENAATFNPESIAEGFESAVVVNGTNYTVEMKIPFKTITPAN
GRKIGFDAQINDAKDGVRQSVAIWNDLTGQGWQDPSVFGVLTLTGKPQSGGGPSPTPSPA
PAPEPAVAEDGTVTVKPTIANGRAKASLSGGTLSQALELAAADDTGRKIVVLDIDAEDAE
AVDVELPAGFLAADEPYVIRLRTPLGIVDLPSNMLAGIAGDAETITIAISGVDDLELDEA
VRNRIGDRPAISLNVLADGEAIAWNNPNAPVTVSIPYEPTAEELANPGHLVVWYIDGEGR
ATAVPNGRYDAESGAVVFRTTHFSVYAVAYVVKTFDDIDRVPWAKQAIEAMASRDIIDGS
GGSNFDPHAFVTRAEFAALLVRALELKDTGKTVAMFSDVAKTDEFYDEVRIAKQHGIVSG
NLLNRFNPNSPITRQDMMVMVDLALRAAGRPLPEGGSLLRFKDAGDVAAYARSSAEKLVA
AGIVQGAGGTLVPGNRLTRAEAAVILYRIWAH
NT seq 4419 nt NT seq  +upstreamnt  +downstreamnt
atgagaggcaaactgcgaaaacatgttgcatcgcttctggcgctgctcctgctgatcccc
ggcgggatggccgcgcccgcgtcggcggtggacgatcccgtggtcgtctaccacgagacg
ttcgagcatggcatcggcaaaaccgcgcaatccggcggagccagcctgcagcacgccacg
ggcgtgtacttcgacgggaacaccgacggcggcgcgctgtacgtgacaaaccgcaagaat
gagtgggatgccgcggactactatgtctcgtccattccgctgcagacggggattacgtac
accgtcaccgcgtcggtgtatgcggatccggccgatctgaacggtctggacaagcttacg
atcgtcgccgcggtggtcacgaagaacgatcaatacaggcagcaaaagtcggtggagctc
gagccgggcaaaccggcgacgctgaccgaaacgttcaccgtggaagaccatgacaagtca
ttccgcatccagacggatgccgccggcaaagcaactcctttctacatcggcgagatcaag
ttcgtcctgaccggaacgggcggaccggacgagccggacggcaaggtcgtcctgtcccag
agttttgaagacggcgactacaccggatggtcgcgcaaaagctggggcggtcagggcaca
ttggaagtttcttcggatgtcgcatcggacggctccaagtcgctgaaattcacgaatcgt
gaaagcgctgacagccaaccgctcctgaacgcgaccggcgtcatgaagtcgggacgcacg
tacgatgtctcgctgaaagtgaggctcggagcaggttcgggacaattccatattgcctcc
aagatcaattcaccgctgctggacaaccagtacccgtggctggtcggcaaccaggacgtc
acggcgaacgattggacgacgttcgcggccaagggagtcgagattccggccgacacgagc
gaagtgttgctctggatcgagtcagccgagagcaacacgctgacctcggacatttacatc
gacgaagtgctgatcgtggacgtcacctccggcggcgaggatccgggtgatgtcgatacg
agcggcattttcgacgattttgagagcggcatcgggaactgggtgcgccggttcggcgcg
ggcggcatcgaggtgacgcaggaggacaaccacaccgagggcggcaagcacagcctgaag
acgaccgcttcggcccaatacgacggtccgctgctcgatgtgcacggcaagatggcccgc
ggtcatcagtatgaactgtcggcgtgggtgaaaatggcccggggcgaagagccgacggta
ctccggatcagcatccagtacggcgagagcggctttgcgaacgtatccccgaacgttacg
gttacggatggggagtgggtgaagctgagcggccggtacacgcagtccgtgacgcccggc
gatcacctgaacgcctatgtggaagtggcgaacgattacggcgggccgcgaaccttcctg
atcgacgatttcgaactgaaatacatcgggccggtggccggaccgaatccggatttcacg
ctcccggcgatcaaggacatctacaaggaccaattcctgatcggcaacatcatgaacccg
ggcaatttcgacgacgaaatccggtcgaagatgctgaagcatcattacaatctgctgacc
gcggagaacgcgatgaagccggagtacgcctacaaaccgggcacccgggagttcgacctg
acggacgagatcgcgctggccgagcaggccatcgcgaacggcttcaaggtgcatggccac
gtcctcgtatggcactcgcaatcaccggattggctgcatacccaggtggatgccaacggc
actccgctccgggatgcgaacggcaacattctctatctggacaaggaagaggcgctgaac
aatctccgcacccacatccggaccgtcgtcaagacgaccggcgaccgggtgatttcctgg
gatgtcgtgaacgaagcgatgaacgacaacccgcccaacccggcagactggcgcgattcg
ctgcgccgttcgggatggtattacgcgatcggtccggactacatctatgaagcttacaag
accgctcgcgaagtgatcgacgagaacggctgggacatcgagctgtactacaacgactac
aacgatgacaaccagaacaaggcgacggctatcgccaacatggtcaaagagctcaacgag
cggtacgcggcggaaacgaacagcgacaagaagctcattgacggcatcggcatgcagtcg
cactacaacctgaacaccaaccccgacaatgtgcgggcatcgatcgaacggatcatcggc
ctcggcttgaaggtcggcatcaccgagctggacgtcatggccggaacgaacggcacgatc
accgaggaccaggcgatccggcaaggctggctgtacgcgcagctgttccaactgtacaag
gaatatgccgatcatatcacgcgcgtcaccttctggggcgtcgacgacggcacaagctgg
cgatcggagaacagcccgctgctgttcgacggccgttatcaggcgaaaccggcgtactac
gccgtcatggatcccgccaagttcatcgaagatcatccgccggcggaaaaagagtaccag
gaaggcaccgccgcttacggcacacccgccgtggacggaacggaggacgcggtatggagc
cgggcggaggagctgccgatcgcacgcttccagacggcgcacaacggcgcgaccggcacg
gcccgggtgctctgggatgaccggaatctgtacgtgctgatcaaggttcaggataccgcg
ctggatcagacgagcgatctgccgtacgaacaggattccgtcgaagtcttccttgacgag
acgaacagcaaggcgccgtcctacggcccggggatcggccagtaccgggtcaactacgag
aacgccgccacgttcaatccggagagcattgccgaagggttcgagtccgcggtcgtcgtg
aacggcacgaactacaccgtcgagatgaaaattccgttcaagacgatcacgccggcgaac
ggccgcaagatcggattcgacgcgcagatcaacgacgcgaaagacggcgtgcgccagagc
gtggcgatctggaacgacctgacgggccagggctggcaggatccgtccgtattcggcgtg
ctgaccctgaccggcaagccgcaaagcggcggcggtccgtcgccaacgccctcgccggcg
cccgctccggagccggccgtggcggaagacggcaccgtgaccgtcaagccgacgatcgcg
aacggccgggcgaaggcgagcctgagcggcggcacgctctcgcaggcgcttgaactcgcg
gcggcggacgacaccggccgcaagatcgtcgtccttgacatcgatgcggaagacgctgaa
gccgtcgacgtggaattgccggccgggttcctggccgctgacgagccgtatgtcatccgg
ctcaggacgccgctgggcatcgtcgacttgccgtcgaacatgctggcgggcattgccggg
gatgcggagacgatcaccatcgccatttccggcgtcgacgacctcgaactggatgaagcc
gtgcgcaaccggatcggcgatcggccggcgatcagcctgaatgtgctggcggacggcgag
gccatcgcctggaacaacccgaacgcgccggtcaccgtgtccatcccgtacgagccgacg
gcggaagagctcgcgaatccgggtcatctcgttgtctggtatattgacggggaaggccgc
gcaacggccgtgccgaacggccgctacgacgccgaatccggcgccgtcgtgttccgcacg
acccatttcagcgtctatgccgtcgcttacgtcgtgaagacgttcgacgacattgaccgg
gtgccgtgggcgaagcaggcgatcgaagcgatggcttcccgcgatattatcgacggaagc
ggcggttcaaacttcgatccgcacgccttcgtcacccgcgccgaattcgccgccctgctc
gtccgcgcgctcgaactgaaggatacgggcaaaaccgtcgcgatgttcagcgatgtggcg
aagacggacgaattctatgacgaagtgaggattgccaaacagcacggcatcgtcagcgga
aacctgcttaaccggttcaatccgaacagccccatcacccgccaggacatgatggtgatg
gtcgatctggcgctccgggccgcaggcagaccgcttccggaaggcggctctctcctccgg
ttcaaggatgccggcgacgtggccgcatatgcccggagcagcgccgagaagctggtggcg
gcgggaattgtgcagggagcaggcggcacgctcgttcccggcaaccgtctgacgcgcgcg
gaagccgccgtcatcctgtaccgaatctgggcgcactga

DBGET integrated database retrieval system