KEGG   Thermobacillus composti: Theco_0248Help
Entry
Theco_0248        CDS       T02394                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
tco  Thermobacillus composti
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:tco00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
275589..277046
Genome map
AA seq 485 aa AA seqDB search
MTSEVRVRYAPSPTGHLHIGNARTALFNYLFARSAGGKFIIRIEDTDTKRNVEGGEQNQL
QYLRWLGVDWDEGPDVGGPYGPYRQTERLDYYRELTDDLMKRGLAYKCYCTEEELERERE
EQAARGETPRYSGRCRHLTDAERAALEAEGREASVRFRVPEGKTYAWNDMVKGEISFESE
GFGDFVIVKKDGIPTYNFAVVADDHGMKISHVLRGEDHISNTPRQLMIYEAFGWEPPVFG
HMTLIVNEQRKKLSKRDESIIQFIEQYDKLGYLPEALFNFIALLGWSPEGEQEIFTREEL
TKIFTPARLSKSPAVFDTQKLAWMNNDYIKRADADRIAALCVPHLQAAGFLPAEPDQAQL
EWTKRLVALVQEKLRSAADIVPLAEVFFRDDLADEPEAAEVLREEHVPTVLRAFLDALRS
ADEWTADSVKALIKGVQQATGFKGKQLFMPIRAALTGQTHGSDLNETIVLLGREKAVQRL
QQRLG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcgaagtccgcgtccgttatgcgccgtcgccgacggggcatctgcacatcggc
aacgcgagaacggcgctgttcaactatctgttcgcgcgcagcgcgggcggaaaattcatc
atccggatcgaagacaccgacacgaaacgcaacgtcgaaggcggcgagcagaaccagctg
caatatttgcgctggctcggcgtcgattgggatgaaggccccgatgtcggcgggccgtac
ggtccgtaccggcagacggagcggctggactactaccgggagctgacggacgacctgatg
aagcgcggcctcgcctacaagtgctactgcacggaggaagagctggagcgggagcgcgaa
gagcaggcggcccgcggcgagacgccgcgctattccggcagatgccggcacctgaccgac
gcggagcgcgcggctctggaagcggaaggccgcgaggcgagcgtccgtttccgggtgccg
gaagggaaaacgtacgcctggaacgatatggtgaagggcgagatttcgttcgagtccgaa
ggcttcggcgatttcgtcatcgtgaaaaaagacggcatcccgacctacaacttcgcggtt
gtcgccgacgaccacgggatgaagatcagccatgtgctgcgcggcgaggatcacatctcg
aacacgccgcgccagctcatgatctatgaagcgttcggctgggagccgccggtgttcggc
catatgacgctgatcgtgaacgagcagcggaagaagctgagcaagcgcgacgagtcgatc
atccaattcattgagcagtacgacaagctcggctatctgccggaagcgctgttcaatttc
atcgcgctgctcggctggtcgccggagggcgagcaggagatcttcacccgggaagagctg
acgaagatcttcacgccggcgcggctcagcaagagcccggccgtgttcgacacgcagaag
ctggcgtggatgaacaacgactacatcaagcgggccgacgcggaccggatcgcggcgctc
tgcgtgccgcatctgcaggcggcgggtttcctgccggcggagccggatcaggcgcagctg
gagtggacgaagcggctcgtggcgctcgtccaggagaagctgcgcagcgcggcggatatc
gtgccgctcgccgaggtgttcttccgcgatgacctcgcggacgagccggaggcggccgag
gtgctgcgcgaggagcatgtgccgacggtgctgcgcgcgttcctggacgcgctccgctcc
gcggacgaatggacggcggacagcgtcaaggcgctcatcaagggcgtgcagcaggcgacg
ggattcaagggcaagcagctgttcatgccgatccgcgcggccttgacgggccagacgcac
ggttcggacctgaacgagacgatcgtactgctcggccgggagaaagcggtgcagcgcctg
cagcagcggctgggttga

DBGET integrated database retrieval system