KEGG   Thermobacillus composti: Theco_0425Help
Entry
Theco_0425        CDS       T02394                                 

Definition
family 4 glycosyl hydrolase, alpha-galactosidase/6-phospho-beta-glucosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
tco  Thermobacillus composti
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tco00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tco00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tco00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
434801..436099
Genome map
AA seq 432 aa AA seqDB search
MSKITFLGAGSTVFAKNVLGDCMLTPALQGFELALYDIDLERLKDSENMLNNLKATTGST
CRIKSYTDRKEALRGAKYIVNAIQVGGYDPCTITDFEVPKKYGLRQTIGDTVGIGGIFRN
LRTIPVMLDFARDIQEVCPDALFLNYTNPMAVLTNVMNTYGGVRTVGLCHSVQACVPHLF
KSLGMDPSGVQWKIAGINHMAWLLEVTKDGVDLYPEIKRRAREKQKEKHDDMVRFELMFR
FGYYVTESSEHNAEYHPYFIKKQYPELIEKYNIPLDEYPRRCVKQIEDWKRMRESLVNNV
NLQHQRSNEYASYIFEAIETDVPFKIGGNVMNTGLITNLPKEACVEVPCLVDASGVTPTY
VGDLPPQLAALNRTNINTQLLTIEAAITRKKEHIYHAAMLDPHTSAELSIDDIVALCDDL
IEAHGDWLPKFH
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaaagattacgtttctcggcgccggcagcaccgttttcgccaaaaacgtcctcgga
gactgcatgctgacgccggccctgcaaggattcgaactggcgttgtacgatattgacctg
gagcggctgaaagactcggagaacatgctcaacaatctcaaggcgacgaccggcagcacc
tgccgcatcaaatcgtacaccgaccggaaggaagcgctgcggggagccaaatacatcgtc
aacgcgatccaggtcggcggctatgacccgtgtacgatcaccgacttcgaagtgccgaag
aaatacgggctgcgccagacgatcggcgacacggtggggatcggaggcattttccggaac
ctgcggacgatcccggtcatgcttgatttcgcgcgggacatccaggaagtgtgcccggac
gcgctgttcctgaattacacgaacccgatggccgtgctgacgaacgtcatgaatacatac
ggcggcgtccgcaccgtcggcctgtgccacagcgtgcaggcttgcgtcccgcacctgttc
aagtcgctgggcatggacccgtccggcgtgcagtggaagatcgccggcatcaaccatatg
gcctggctgctggaagtgacgaaggacggggtggacctgtaccccgagatcaagcggcgg
gcgcgggagaagcagaaagagaagcacgacgacatggtccgcttcgagctgatgttccgc
ttcggctattatgtgacggaatcgtccgagcacaacgccgagtatcatccgtatttcatc
aagaagcaatatcccgagctgatcgagaagtacaatattccgctggacgagtatccgcgc
cgctgcgtgaagcagatcgaggactggaaaagaatgcgggagtcgctcgtgaacaacgtc
aatctgcagcaccagcgttcgaacgagtatgcgtcctatatttttgaagcgatcgagacg
gatgtgccgttcaagatcggcggcaacgtcatgaacaccgggctgatcacgaatctgccg
aaggaagcttgcgtcgaggtgccctgtctggtggacgccagcggggtgacgccgacgtat
gtcggcgatctgccgccgcagctcgccgcgctgaaccggacgaacatcaatacgcagctg
ctgacgatcgaagcggcgattacgcggaagaaggagcatatctatcacgcggcgatgctc
gatccgcacacgtcggccgagctgtcgatcgacgacatcgtcgccctgtgcgacgatctg
atcgaggcgcacggcgactggctgccgaagttccactaa

DBGET integrated database retrieval system