KEGG   Thermobacillus composti: Theco_0462Help
Entry
Theco_0462        CDS       T02394                                 

Definition
O-glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
tco  Thermobacillus composti
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tco00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:tco00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
482829..484181
Genome map
AA seq 450 aa AA seqDB search
MERSKIRWFSSTRQAMWQKKAAGSGAQTADAGNPNLTITGETFQTVEGFGGCFNELGFVA
LNRLSEAQRNRVLDALFAPDGELKLDLCRLPIGASDYALEWYSLNETDGDLAMAHFSIER
DRKYLIPYIREALKRNPRLKLFASPWSPPTWMKHPRAYNYGTLRWEPEILEAYALYFVKF
VQAYREEGITIHQIHVQNEVVADQKFPSCVWTGEQLRDFIRDYLGPAFERHGIEAEIWLG
TINAPDMWDIYTKKISTDYDDYAHTVLSDPGAYKYIKGVGYQWAGKNAIQRTAASYPELR
YMQTENECGDGNNTWEYARYVFNLFQHYFFNGVSSYVYWNMVLEPKGRSTWGWEQNAMIT
ADPETAQPVFNPEYYVMKHYSHFVAPGSVRLGLKGMWTGNAIAFAAPNGERVVVISNPFK
DARTLRLSDGAHVHVFEMEPESFNTIVLPG
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggaacggagcaaaattcggtggttttcaagcaccagacaggcgatgtggcagaagaag
gcggccgggagcggcgcgcagacggcggatgccgggaatcccaacctgacgattacgggc
gagacgtttcagaccgtcgaagggttcgggggctgcttcaacgagctgggctttgtcgcc
ctgaaccggctgtccgaggcgcagcggaaccgggtgctggacgcgctgttcgcgcccgac
ggcgaactgaagctcgacctgtgccgcctgccgatcggggccagcgattatgcgctcgaa
tggtacagcctgaacgagaccgacggcgatctggcgatggcgcatttctcgatcgagcgg
gaccgcaaatacttgatcccgtacatccgggaagcgctgaagcgcaatccgcggctcaag
ctgttcgcttcgccttggagcccgccgacgtggatgaagcatccgcgggcctacaactac
ggcacgctgcgatgggagccggagattctggaggcttacgcgctctatttcgtcaagttc
gtccaggcgtatcgggaagaaggcatcacgattcaccagatccacgtgcagaacgaagtg
gtcgcggaccagaagttcccgtcctgcgtctggacgggcgagcaactgcgcgatttcatc
cgcgactatctggggccggccttcgagcggcacgggattgaagccgagatctggctcggc
acgatcaacgcgccggacatgtgggacatctacaccaaaaaaatatcgacggactacgat
gactatgcccacactgtgctcagcgaccccggggcgtacaaatacatcaagggcgtcggt
tatcagtgggccggcaaaaacgcgatccagcgcacggcggccagctatccggaactgcgc
tacatgcagaccgagaatgaatgcggcgacggcaacaacacgtgggagtacgcccggtac
gtcttcaatctgttccagcattatttcttcaacggcgtaagcagctatgtttactggaac
atggtgctggagccgaagggccgcagcacgtggggctgggagcagaacgcgatgatcacc
gccgatccggagaccgcgcagccggtgttcaatccggagtattacgtcatgaagcattac
tcgcatttcgtcgcgccgggttcggttcggctggggctcaaaggcatgtggaccggcaac
gccatcgctttcgcagcgccgaacggggaacgggtcgtcgtcatctccaatccgttcaag
gacgcccgcacgctccggctgtcggacggcgcgcatgtgcacgtgttcgagatggaaccg
gagtcgttcaacacgatcgtgctgccgggatga

DBGET integrated database retrieval system