KEGG   Thermobacillus composti: Theco_0520Help
Entry
Theco_0520        CDS       T02394                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tco  Thermobacillus composti
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tco00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Theco_0520
Enzymes [BR:tco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Theco_0520
Exosome [BR:tco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Theco_0520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
539811..541301
Genome map
AA seq 496 aa AA seqDB search
MGGPYLLAIDQGTTSSRAILFDAEGHIAAKAQQEIRQHYPQPGWVEHDAEEIWISVHSVV
ATAIAQAGIQPDQISAIGITNQRETTVVWDRKTGRPIHHAVVWQSRQTEDICERLRAEGA
EPLIRERTGLLIDPYFSGTKIRWLLDHVDGARERAERGELLFGTIDSWLIWKLTDGALHV
TDVTNASRTLLFNIHKLEWDEELLRLIGVPAAMLPEVRPSSEVYGRTSPNAFFGCEVPIA
GAAGDQHAALFGQGCFEPGMAKNTYGTGCFMLMNTGEKAIPSKHGLLTTIAWGAGGRVEY
ALEGSVFVAGSAIQWLRDGLRIIKAAPDSEAYAGRVESSEGVYVVPAFVGLGTPYWNSSV
RGAVFGLTRGTSKEHFIRAVLESIAYQSKDVLDAMEEDAGVRLKALRVDGGAAMNDLLMQ
FQADLLGTPVERPVHYETTALGAAYLAGLGAGVFGGREEIAAQWRLDKRFEPAMEAAERD
RLYAGWQRAVRAAMAF
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcccttacttgcttgccattgaccaggggacaacgagctcgcgggcgatcctt
ttcgatgcggaaggccatatcgcggccaaggcccagcaggagatccggcagcattatccg
cagccgggctgggtcgagcacgatgccgaggagatctggatctccgttcacagcgttgtg
gccacggcgattgcgcaggccggcatccagcctgaccagatcagcgccatcggcattacg
aaccagcgggagacgacggtcgtctgggaccgcaagaccggtcgtcccatccatcatgcg
gtcgtctggcagtcccgccagacggaggacatctgcgaacggctgcgcgcggaaggcgcc
gagccgctcatccgggagcggaccgggctgctcatcgacccgtatttctcgggcacgaaa
atccgctggctgctcgaccatgtggacggcgcgcgggagcgggcggagcggggcgagctg
ctgttcggcacgatcgactcctggctcatctggaagctgacggacggcgctctccacgtc
accgacgtgacgaacgcgtcgcggacgctgctcttcaacattcacaagctggaatgggac
gaagagctgctgcggctcatcggtgtgccggccgcgatgctgccggaagtgcggccgtca
tcggaggtgtacggccgcacgtcgccgaatgcgttcttcggctgcgaagtgccgatcgcc
ggggcggcgggcgaccagcacgcggcgctgttcgggcagggatgcttcgagcccggcatg
gcgaagaacacgtacgggaccggctgcttcatgctgatgaataccggcgagaaggcgatt
ccgtcgaagcacggcctgctcacaacgatcgcctggggcgcgggaggacgggtcgagtac
gcgctggaaggtagcgtgttcgtcgccggttccgcgatccagtggctgcgcgacggcctg
cgcatcatcaaggcggcgcccgattcggaggcgtatgcgggccgggtcgaatcgagcgag
ggcgtctatgtcgtgccggcgttcgtcggactcggcacgccgtattggaacagcagcgtg
cgcggcgccgttttcggcttgacgcggggcacgtcgaaggagcatttcatccgggcggtg
ctggagtcgatcgcctaccagtcgaaggatgtgctggacgcgatggaggaggacgcgggc
gtccggttgaaggcgctccgcgtcgacggcggcgcggcgatgaacgatctgctcatgcag
ttccaggccgacctgctgggcacgcccgtcgagcggccggtgcactacgagacgacagcg
ctcggcgcggcgtacctggccggactcggcgccggcgtattcggcggccgggaggagatc
gccgcgcaatggcggcttgacaagcggttcgagcccgcgatggaagccgcggagcgcgac
cggctgtatgccgggtggcagcgcgcggtgcgggcggcgatggcgttttga

DBGET integrated database retrieval system