KEGG   Thermobacillus composti: Theco_0555Help
Entry
Theco_0555        CDS       T02394                                 

Definition
glycosyl hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
tco  Thermobacillus composti
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tco00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
576845..578707
Genome map
AA seq 620 aa AA seqDB search
MSRMGRTAGWILSLMLVFGLAAGCADGGNDAERSPEHAEAAGPAGSGSDAGDAAGGEEGE
GTLNAGELVYDGEDIKVNQVGYLPDAPKVAVLEGEAKAERFQVVDAETQAVVFEGEVGRA
EIDANSGERVRHLDFSALREEGEYEVVVPGAGASRKFRIARNVYYAPFFDALRSYTLGRA
GLAIDDPITGLKHEAGHLQDAEARLDIDHPHAPAGTPVDVSGGWYDAGDYGKYVTPGAVT
AAQLLLAYELYPEKFTAGQLKFPDGFASDVPGLPDALAEVKVELDWLLKMQRPDGAVYHK
VSGLAWPGMIRPEDDTQPRYVFGMTTYGTGMFAGAMALAARVYEPFDAEYAGRLLEAAER
AWRFLEAHPEPIVLKSERQDNGSGGYDKNGDQDDRFWAAAELLKTTGDARYAAYIGEKLS
HQLQREPVIIGWGSTLALGQFAYATAEAGDPAVKASLRQKLVKAADDIVGRIERDGYRYA
LSPNEYTWASAKNGMAKAELLLLAHELEPKEAYVHGALDQLHYTLGRNALGTTYLTGSGT
EMPDYPHSRMITGTGTYIPGLLVGGPNKFGGDPELDKMLERESPPPAKAYLDSPGSWATN
EYAIDYNAPLVFVLTYFAEP
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggatgggcaggacggcgggatggatcttgagcctgatgttggtgttcggactt
gcggccggatgcgcggacggcgggaacgatgcggagcgctcgccggagcatgcggaggcg
gccggtcccgcgggcagcggatcggatgccggcgatgcggcgggcggagaggagggcgaa
ggaacgttgaatgccggggagctcgtctacgacggcgaggatatcaaggtcaatcaggtc
ggctatctgcccgacgcgcccaaggtggcggtgctcgaaggcgaggccaaggccgaacgg
ttccaggtcgttgacgcggagacgcaggcggtcgtcttcgaaggtgaggtcggccgggcc
gagatcgacgcgaattcgggcgaacgggtgaggcatctggatttcagcgccctgcgggaa
gaaggcgaatatgaggtcgtcgtgcccggagcgggggcgtcgcggaagttccgcatcgcc
cggaacgtctattacgcgccgttcttcgacgcgctccgctcctatacgctcggccgcgca
gggctggcgatcgacgacccgataaccgggctgaagcacgaagccggacatctgcaggat
gccgaagcgcggctcgacatcgaccatccgcacgcgcccgcgggcacgccggtcgacgtc
agcggcggatggtacgatgccggcgactacggcaagtacgtgacgccgggcgcggtgacg
gccgcccaattgctgctcgcatacgaactgtacccggagaagttcaccgccgggcagctc
aagttccctgacgggttcgcgagcgatgtgccggggctgcccgacgcgctggcggaagtg
aaggttgagctggactggctactcaagatgcagcggcctgacggcgccgtataccacaag
gtgtcgggcttggcgtggccgggcatgatccggccggaggacgacacgcagccgcggtac
gtcttcggcatgacgacctacggcaccggcatgttcgccggcgccatggcgttggcggcg
cgcgtctacgagccgttcgatgccgaatacgccggaaggctgctcgaagcggccgagcgg
gcctggcgcttcctcgaagcgcatccggagccgatcgtcctgaagagcgagcgccaggac
aacggttcgggcggctacgacaagaacggcgaccaggacgaccggttctgggcggcggcc
gagctgctgaagacgaccggcgatgcgcggtacgcggcgtacatcggcgagaagctgtct
catcagcttcagcgcgagccggtcatcatcggctggggctcgacgctggcgctcggacag
ttcgcctacgcgacggcggaagcgggagatccggccgtcaaggcgtcgctcaggcagaag
ctggtgaaggcggcggacgacatcgtcggccggatcgagcgggacggctaccgttacgcg
ctgtcgccgaacgagtacacgtgggcgtccgccaagaacggcatggcgaaggccgagctg
ctcctgcttgcgcatgagctcgagccgaaggaagcctatgtgcacggcgcgctcgaccag
ttgcattacacgctggggcgcaacgcgctcggcacgacgtatttgaccggttcggggacg
gaaatgccggactatccccacagccggatgattacgggaacgggcacgtacattccgggg
ctgctcgtcggcgggccgaacaaattcggcggcgatccggagctggacaaaatgctggag
cgcgagtcgccgccgccggcgaaggcttacctggattcgcccggatcatgggcgacgaac
gagtacgcgatcgactacaatgcgccgctcgtattcgtgctgacatactttgcagagcct
tga

DBGET integrated database retrieval system