KEGG   Thermobacillus composti: Theco_1248Help
Entry
Theco_1248        CDS       T02394                                 

Definition
(GenBank) ROK family protein, putative glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tco  Thermobacillus composti
Pathway
tco00010  Glycolysis / Gluconeogenesis
tco00052  Galactose metabolism
tco00500  Starch and sucrose metabolism
tco00520  Amino sugar and nucleotide sugar metabolism
tco00521  Streptomycin biosynthesis
tco01100  Metabolic pathways
tco01110  Biosynthesis of secondary metabolites
tco01120  Microbial metabolism in diverse environments
tco01130  Biosynthesis of antibiotics
tco01200  Carbon metabolism
Module
tco_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tco_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theco_1248
   00052 Galactose metabolism
    Theco_1248
   00500 Starch and sucrose metabolism
    Theco_1248
   00520 Amino sugar and nucleotide sugar metabolism
    Theco_1248
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Theco_1248
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Theco_1248
Enzymes [BR:tco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Theco_1248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Hydant_A_N Urease_gamma
Motif
Other DBs
NCBI-ProteinID: AGA57414
UniProt: L0ECS2
Position
1303221..1304171
Genome map
AA seq 316 aa AA seqDB search
MTDLRYIGIDIGGTAVKVGVCDAEGRLLHTFEGPTETDKGRERVLDNIAAYARRCADEAS
LDWERIAGVGVGLPGQIDAARGVVEFIANLPLAGVRLKDHLESVLGRPVRISNDANVAAL
GEAWSGAGRGVASSVTFTLGTGVGGGIVVGGRVIDGFSGMGGELGHMVIVPDSEAVRCGC
GKTGCLETVASATGIVRMAREAVEMGVRTSLAEAGELTAKAVFDAARAGDEAARRIVGRA
AHYLGRSMALVAVVINPQRFIIGGGVAKAGEFLLEQVREAFRAHAIGRAGEGVSIVAAKL
GNNAGVIGAAGLVRKL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgacggacttacggtatatcggcatcgacatcggcggcacggccgtcaaggtcggcgtc
tgcgacgcggaaggcaggctgcttcatacgttcgagggacccacggaaacggacaagggc
cgggagcgggtgctggacaacatcgccgcgtacgcccgccggtgcgccgatgaagcttcg
cttgactgggagcggatcgcgggcgtcggcgtcgggcttcccggccagatcgacgcggcg
cggggcgtcgtcgaatttatcgccaatctgccgcttgcgggcgtgcgattgaaggatcat
ctggagtcggtgctcggcaggccggtgcgcatcagcaacgacgcgaacgttgccgcgctc
ggggaagcctggtccggcgcgggccggggcgtcgcgagcagcgtgacattcacgctcggc
accggcgtgggcggcggcatcgtcgtcggcggccgcgtgatcgacggcttctccggcatg
ggcggggaattgggccatatggtgatcgtgcccgattccgaggcggtccggtgtggatgc
ggcaagaccggctgcctggagacggtggcgtcggccaccggcatcgtgcgcatggcgcgc
gaggcggtggagatgggcgtccggacgtcgctcgccgaggccggagaactgacggcgaag
gcggtgttcgatgcggcccgggccggtgacgaggcggcgcggcgcatcgtcggacgggcg
gcgcattatctcggccggtcgatggcgttggtggcggtcgtcatcaatccgcagcggttc
atcatcggcggcggcgtcgcgaaggcgggcgaattcctgctggaacaggtgcgcgaggcg
ttccgcgcacacgcgatcggacgggcgggcgaaggcgtctcgatcgtcgccgcgaagctc
ggcaacaacgccggcgtgatcggcgcggcggggctcgtccggaagctgtga

DBGET integrated database retrieval system