KEGG   Thermobacillus composti: Theco_1280Help
Entry
Theco_1280        CDS       T02394                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tco  Thermobacillus composti
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tco00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1342481..1343989
Genome map
AA seq 502 aa AA seqDB search
MSRDYLLAIDQSTSGTKALVIDRSGAVVARSEAEHRQYYPAPGWVEHDPIEIYHNVIRVA
RQALRLAGVEARQLAALTITNQRETAVLWDRTTGLPVHNAIVWQCQRTSGHCARLRDEGH
EPLVQAKTGLMLDPYFSATKWSWMLEHAEGAKAKLEEGKLLAGTIDSWLVWKLTGGRVHA
TDCTNASRTSLYNIYTLDWDDELCALFGVPRKLLPEVKSSDDLFGHTEEPELWDERVPIT
GVIGDSQAALFGQMCHEPGMAKATYGTGTSVLMNIGMKPVSPGSGLVTAIAWGRGGTVTY
ALEAIIRTSGDTIKWVRDNLGLFRSFEEMDDLLKEAPDNEGVYLVPAFVGLGAPYWDPDA
RAAITGMSRSTGRAHIVRAALESIAYQVYDAVDFMRRESGVTLTELRADGGASRNATLMQ
FQADLLDNAVVASEVAELSAMGAAWLGGLGVGLWPSVERLPGNSAGRRYEPAMAAAERER
LLEGWKKAVRSVLNDRSAGGKG
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagcagggactatttgctggccatcgatcagagcacgtccggcacgaaggcgctcgtc
atcgaccgctccggcgcggtcgtcgcgagaagcgaagccgaacaccggcaatattatcct
gccccggggtgggttgaacatgaccccattgaaatctatcataatgtcatccgggttgcc
cggcaggcgctccgactggcgggcgtcgaggcccggcagctcgcggcgctgacgatcacg
aaccagcgggagacggccgtcctgtgggaccggacgaccggcctcccggtccataacgcc
atcgtctggcagtgccagcggacgagcggccattgcgcgcggctgcgggatgaagggcat
gaaccgctggttcaggcgaagaccgggctcatgctcgacccctacttctccgcgacgaaa
tggagctggatgctggagcacgcggaaggcgcgaaggcgaaactcgaggaagggaagctg
ctcgccggcacgatcgacagctggctcgtctggaagctgaccggcggccgggtgcatgcc
accgactgcacgaacgcgagccgcaccagcctgtacaacatctacacgctggattgggac
gacgaactgtgcgccttgttcggcgtgcccaggaagctgctgccggaagtgaagtcgtcg
gatgatctcttcggccataccgaagagccggaactgtgggatgagcgggtgccgatcacg
ggggtaatcggcgactcccaggccgcgctgttcggccagatgtgccacgagccgggaatg
gccaaggccacctacggcacgggcacctcggtgctgatgaacatcggcatgaaaccggtg
tccccggggagcggactcgtcaccgccattgcctggggaaggggcggcaccgttacctac
gcgctcgaggcgatcatccgcacgagcggcgacacgatcaaatgggtgcgggacaatctc
ggcctgttccgctcgttcgaggagatggatgacctgctcaaggaggcgccggacaatgag
ggcgtctacctcgtgcccgcgttcgtcggcctgggcgctccgtactgggacccggacgcg
cgcgcggcgatcacggggatgtcgcggtcgacgggcagggcgcacatcgtccgggccgcg
ctcgagagcatcgcgtatcaggtgtacgacgccgtcgacttcatgcggcgggaatccggc
gtcacgctgaccgagctccgcgccgacggcggcgcgtcgcggaacgcgacgctgatgcag
ttccaggccgatctgctggacaacgccgtcgttgcgtcggaggtcgccgaactgtccgcc
atgggcgccgcctggctgggcgggctcggcgtgggtctctggccgtccgtggaacggctg
cccggcaatagcgccggccgccggtacgagcccgcgatggcggccgcggagcgggagcgc
ctgctcgaaggctggaagaaggccgtccgttccgtgctgaacgaccggtctgcgggcggc
aagggataa

DBGET integrated database retrieval system