KEGG   Thermobacillus composti: Theco_1313Help
Entry
Theco_1313        CDS       T02394                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
tco  Thermobacillus composti
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tco00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Theco_1313
   00051 Fructose and mannose metabolism
    Theco_1313
Enzymes [BR:tco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Theco_1313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1380222..1381535
Genome map
AA seq 437 aa AA seqDB search
MAYFENVGKIQFEGKGSDNPFAYKHYNPQEKVLGKTMEEHLRFAVAYWHTFTGTGADPFG
VGTAIRSWDKFDGMDRAKARVEANFEFLEKTGIDYYCFHDVDIAPEGDTLQETHKNLDTI
VAMLKEFQKSTGKKLLWNTANMFTNPRYVFGAATTCNADVYAHAAAQVKKMLEVGKELGA
ENYVFWGGREGYETLLNTDMALELDNLARFYHMAIEYAKEIGFNAQFLIEPKPKEPTKHQ
YDFDAATTIAFLQKYGLKDHFKLNLEANHATLAGHTFEHELRVAAINDMLGSIDANQGDL
LLGWDTDEFPTDLYSVTLTMYEILKAGGFKTGGINFDAKVRRGSFEPEDLFLAHIAGVDT
FAWGLKAAAKIIEERVLDSVIEERYASFREGIGKEIVEGKATLKSLEAYALQNKPIVNRS
GRQERIKLVLNEIIYSV
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcttatttcgagaacgtcggcaagatccagttcgagggcaaaggctcggacaacccc
ttcgcgtacaaacattacaacccgcaggagaaggtgctcggcaagacgatggaggagcat
ctccgcttcgccgtcgcgtactggcacacgttcacgggcaccggcgcggatccgttcggc
gtcggcacggcgatccgcagctgggacaagtttgacggcatggaccgggcgaaggcgcgc
gtcgaagcgaacttcgaattcctggagaaaacgggcatcgactactactgcttccatgac
gtcgacatcgcgccggaaggcgacacgctgcaggagacgcacaagaacctcgacaccatt
gtcgccatgctgaaggaattccagaagtcgacgggcaagaagctgctctggaacacggcg
aacatgttcacgaatccgcgctacgtgttcggcgcggcgacgacctgcaatgccgatgtc
tacgcgcatgcagccgcgcaagtgaagaagatgcttgaagtcggcaaggagctcggggcg
gagaactacgtgttctggggcggccgcgaaggctacgagacgctgctgaacaccgacatg
gcgctcgagctggacaacctggcgcgcttctatcatatggccatcgaatatgcgaaggag
atcggcttcaacgcgcagttcctgatcgagccgaaaccgaaggagccgacgaagcatcag
tacgacttcgatgcggcgacgacgatcgccttcctgcagaagtacggcctgaaagatcac
ttcaaactgaaccttgaggcgaaccatgcgacgctcgccggccatacgttcgagcatgaa
ctccgcgtcgcggcgatcaacgacatgctcggttcgatcgatgcgaaccagggcgacctg
ctgctcggctgggataccgacgaattcccgaccgatctgtacagcgtgacgctgacgatg
tacgaaatcctgaaagcaggcggcttcaagaccggcggcatcaacttcgacgcgaaagtg
cgccgcggttcgttcgagccggaggatctgttcctcgcgcacatcgcgggcgtcgacacg
ttcgcatggggtctgaaggcggcggccaagatcatcgaagaacgcgttctggacagcgtc
atcgaagaacgctacgcttcgttccgcgaaggcatcggcaaggagatcgtcgaaggcaag
gcgacgctgaagagcctcgaagcttacgcgcttcagaacaagccgatcgtgaaccgctcg
ggccgtcaggaacgaatcaagctggtactcaacgaaatcatttacagcgtataa

DBGET integrated database retrieval system