KEGG   Thermobacillus composti: Theco_1404Help
Entry
Theco_1404        CDS       T02394                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
tco  Thermobacillus composti
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tco00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1472860..1474380
Genome map
AA seq 506 aa AA seqDB search
MAAAAEPKTIVVVGGGITGLAAAYYLRRSAEAAGLPVRVAIAEASERLGGKIETLRKDGF
VIEKGPDSFLARKKAILDLAVDLGIEEELVPINPSGKKSFIVFRGKLHPMPDGLMLGIPT
EIAPMLKTGLLSPAGKLRAGLDFVLPARKGNDDESIGDFLTRRLGREVVERIAEPLLAGI
YAGELDKLSLRATFPQFREAELKHGSLILGMRRAMRRRPAPAAGAGGAAGQAGQAAQTPA
DAILARYKGAPFLNFRRGLATLVEALERELSGAEWRRGRKATALRKGAAGASDEPARRYA
VVFDDGEELQADAVVVTAPAYEAEALLRDHVDCGMLRAVRYASVANVVLAFDKASFGREF
AGSGFLVPRTEGRQITACTWTSTKWLHTSPPDKVLLRCYIGRSGDEDAVSLPDNQLIRLV
RHDLEELIGVTAAPVMTEVTRLHRSMPQYPVGHVEAMRDFKRKLAEALPGVWTAGAAFDG
IGLPDCIRQAKETAEAAIRELCGSAS
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagcagcagagccgaaaacgatcgtcgttgtcggcggcgggatcaccgggctc
gccgccgcttactatttgcgcaggtcggccgaagccgccggattgcccgtccgcgtggcg
atcgcggaggcgtcggagcggctcggcggaaagatcgagacgctgcggaaggacggcttc
gtcatcgagaaggggccggattcgttcctcgcccgcaagaaggcgatcctcgatttggcc
gtcgatctcggcattgaagaggagctcgtgccgatcaatccgtcgggcaagaagtcgttc
atcgtcttccgcggcaagctgcatccgatgccggacggcctcatgctcggcattccgacc
gagattgcgccgatgctgaagaccggtctcctgtcgccggcgggcaagctgcgcgccgga
ctcgacttcgtcctgcccgcgcggaaagggaatgacgacgagtcaatcggcgatttcctg
acgcggcggctcggacgcgaagttgtcgagcggattgccgagccgcttctggccggcatc
tacgcgggggagctggacaagctcagtctgcgggcgacgttcccgcagttccgcgaggcg
gagctgaagcacggcagcctgatcctcggcatgcgccgcgccatgcggcggcgcccggcc
ccggctgccggcgccggcggagcggcggggcaggccgggcaggcggcgcagacgccggcg
gatgcgattcttgcccggtacaagggggcgccgttcctgaatttccgccgcggcctggcg
acgctcgtcgaagcgctggagcgggagctgtccggggccgaatggcggcgcggacggaaa
gcaacggcgctaaggaaaggcgccgccggggcatcggacgagccggctcgccgctatgcg
gtcgtgttcgacgacggggaagaactgcaagccgacgccgtcgtcgtgacggctccggcg
tatgaagcggaggcgctgcttcgggatcatgtcgactgcggcatgctccgcgccgtccgg
tacgcgtccgtcgccaatgtcgtgctggccttcgacaaggcgtccttcggccgcgagttc
gccggttccggcttccttgtgccgcgcacggaaggccggcagattacggcgtgcacttgg
acgtcgacgaagtggctccatacgagcccgccggacaaggtgctgctgcgttgctatatc
ggccgctcgggcgacgaggacgcggtttcgctgccggacaatcagctcattcggcttgtg
cggcacgatctggaggaactgatcggggtgacggctgcgccggtgatgacggaggttacg
cggctccatcgttccatgccgcaatatccggtcggccacgtcgaggcgatgcgcgatttc
aagcggaagctcgccgaggcgctgccgggcgtctggaccgccggcgcggcgttcgacggc
atcgggctgccggactgcatccggcaggcgaaggagacggcggaggcggcgattcgggag
ctgtgcggctccgcttcatga

DBGET integrated database retrieval system