KEGG   Thermobacillus composti: Theco_1506Help
Entry
Theco_1506        CDS       T02394                                 

Definition
family 4 glycosyl hydrolase, alpha-galactosidase/6-phospho-beta-glucosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
tco  Thermobacillus composti
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:tco00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Theco_1506
  Lipid metabolism
   00561 Glycerolipid metabolism
    Theco_1506
   00600 Sphingolipid metabolism
    Theco_1506
Enzymes [BR:tco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Theco_1506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1577015..1578532
Genome map
AA seq 505 aa AA seqDB search
MSFKVTFIGAGSIGFTRSLLRDLLSVPEFRNIRVAFTDISERNLEMVRQLCQRDIDENGL
SIRIEATTDRREALKDAKYVLNTIRVGGLEAFQTDIDIPLRYGVDQCVGDTLCAGGIMYG
QRGIAVMLDICKDIREVAAKDALLLNYANPMAMLTWACNKYGGVRTIGLCHGVQHGHKQI
ADVFGLKKEEVDIICAGINHQTWYIQIRHKGRDLTGELLEAFERHPVYSRTEKVRIDMLR
RFGYYSTESNGHLSEYVPWYRKRPEEIRDWIDLGSWINGETGGYLRVCTEGRNWFETDFP
NWLKEPPLKFRPEDRGYEHGSFIIESLETGRVYRGHFNVVNGGVISNLPDDAIVEVPGYV
DANGISIPHIGDLPLGPAAVCNASISVQRLAVEAAVRGDDFLLRQAFMMDPLVGAVCNPK
EIWQMVDEMLVAQEQWLPQYKEAIAAAKARLEAGRAAGTLIPTRDYQGAARLKVKTVEEM
ERDREEATKNAAAADKGQDREKAKH
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
ttgtcattcaaagtgacgttcatcggcgcgggcagcatcggatttacgcgcagtctgctg
cgggatctgctgtcggtgccggaattccggaacatccgcgttgcgtttacggacatcagc
gaacgtaacctcgagatggtgcgccagctttgccagcgtgacatcgacgagaacggactg
tcgatccggatcgaggcgacgactgaccggcgggaagcgctgaaggacgcgaaatatgtg
ctgaacacgatccgcgtcggcgggctggaagctttccagacggacattgacataccgctc
cgctacggcgtcgaccagtgcgtcggcgatacgctgtgcgcgggcggcatcatgtacggc
cagcggggcatcgccgtcatgctggacatctgcaaggacatccgcgaagtggcggcgaag
gatgcgctcctgctcaactacgcgaatccgatggcgatgctgacgtgggcgtgcaacaaa
tacggcggcgtccgtacaatcggcctctgccatggcgtgcagcacgggcacaagcagatc
gccgatgtgttcggtctgaagaaagaggaagtcgacatcatctgcgccggcatcaatcat
caaacgtggtacatccagattcggcacaagggccgcgatctgacgggcgagctgctcgag
gcgttcgagcgccatccggtatacagccggaccgagaaggtgcggatcgacatgctgcgc
cggttcggctactacagcacggagtcgaacggtcacctgagcgagtatgtaccgtggtac
cggaagcgccccgaagagatccgcgactggatcgatctcgggagctggatcaacggcgag
acgggcggctacctgcgcgtctgcaccgaaggccggaactggttcgagacggacttcccg
aactggctgaaggagccgccgctcaagttccgtccggaagaccggggctacgagcacggc
tcgttcatcatcgagagcctggagacgggccgcgtctatcgcggacatttcaacgtcgtg
aatggcggcgtcatctcgaacctgccggacgacgcgatcgtggaagtgccgggctatgtg
gacgcgaacggcatctccattccgcatatcggcgatttgccgctcggcccggccgccgtc
tgcaatgccagcatcagcgtgcagcggctcgccgtcgaagcggcggtgcgcggcgacgac
ttcctgctgcgccaggcgttcatgatggacccgctcgtcggcgcggtgtgcaatccgaag
gaaatctggcagatggtcgacgagatgcttgtcgcacaggagcaatggctgccgcaatac
aaggaggcgattgcggcggcgaaagcgcggctcgaagccggtcgggcggcgggcacgctc
attccgacgcgcgactatcaaggcgcggcgcggcttaaagtgaagacggtcgaagagatg
gagcgcgaccgcgaagaggcgacgaagaacgcggccgcggcggacaaggggcaggaccgc
gagaaggcgaagcactag

DBGET integrated database retrieval system