KEGG   Thermobacillus composti: Theco_1623Help
Entry
Theco_1623        CDS       T02394                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tco  Thermobacillus composti
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tco00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Theco_1623
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Theco_1623
Enzymes [BR:tco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Theco_1623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1707215..1708987
Genome map
AA seq 590 aa AA seqDB search
MSKAGAWRGTGEGVNLAGWSLRDKIGQMVMAGFDGKAPTDEIRALIRERKLGGVIYFRRN
AGSVAEVARLSAALRELAAEATKVPLWIAVDQEGGMVARLDQGVTVMPGHMALGATRSAK
WARETAYASGAQLMRLGVNLNFAPCLDVNNNPANPVIGVRSFGERPELAAELGIAAIRGY
REAGVVACAKHFPGHGDTVADSHRELPTVPHDRKRLEEVELLPFRLAAAAGADAIMTAHV
RFPALEPDGLPATLSPRILRGLLRDEWGYDGVVFTDCLEMKAIAGTVGVARGAVMAVKAG
ADVVLVSHTPALQKAALDALYEAVEAGEIAEARIDESVRRIAGLKARQSAAVPVGPVPAA
RSDAGTGPDDFDFGGEAAALAREVCRRSVTLVRNERGALPLRRDVPTFVVWPEVRQGTEV
DEALARELTLGRALAPYLSRVKEFRIGTVPGEDEVRETLAEIDRALEDIRERAAVRGEPG
SDRTLLQVVVGTYNAAFAAGQTELVNHLLACEGVRVTAAALRNPYDFLAFPEVHAYAACY
ENTPCMMEALAEVLAGETEARGRLPVTLSERYPFGHGISGFRKERDGEET
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
ttgagcaaagcgggagcgtggaggggaacaggtgaaggcgtgaacctggccggctggagc
ctgcgcgacaaaatcgggcagatggtgatggccggcttcgacggcaaggcgccgacggac
gaaattcgggcgctgatccgcgaacgcaagctcggcggggtgatctatttccgacggaac
gcgggcagcgtcgccgaagtcgctcggctgtcggccgcgctgcgcgaactcgctgcggag
gcgacgaaggtgccgctgtggatcgccgtcgaccaggaaggcggcatggtggcgcgcctc
gaccagggcgtgacggtcatgccgggccacatggcgctcggcgcgacgcgctcggcgaag
tgggcgcgcgagacggcctatgcgtccggcgcgcagctcatgcggctgggcgtcaacctg
aacttcgcgccctgcctggacgtcaacaacaacccggccaatccggtcatcggcgtgcgc
tcgttcggcgagcgtccggaactggcggccgaactgggcattgcggccatccggggatac
cgggaggcgggggtggtcgcctgcgcgaagcattttccgggtcacggcgacaccgtggcc
gattcgcaccgggagctgccgaccgtgccgcacgaccggaagcgcctggaagaagtggag
ctgctgccgttccggctggcggccgccgccggcgcggacgcgatcatgaccgcgcacgtg
cggtttccggcgttggaaccggacggtcttccggcgacgttgtcgccgcgcattctgcgc
ggcctgctgcgggacgaatggggatacgacggcgtggtgtttacggactgtctggaaatg
aaggcgatcgcaggtacggtgggcgtcgcccgcggggcggtgatggcggtgaaggccggc
gcggacgtcgtgctggtcagccatacgccggcgctgcaaaaagccgcgctcgacgcgctc
tacgaggcggtcgaagccggcgaaatcgccgaagcgcgaatcgacgagtcggtgcggcgc
attgcggggctgaaggccagacagtcggcggcggtcccggtcggtcccgttccggccgct
cgctccgatgccgggaccgggccggatgatttcgatttcggcggtgaagcggcggcgctc
gcgcgggaagtttgccggcgcagcgtgacgctcgtgcggaacgagcgcggcgcgctgccg
cttcggcgggatgtgccgacgttcgtcgtctggcccgaggtgcggcagggaacggaagtg
gacgaagcgttggcccgggagctgacgttgggccgggcgctcgcgccgtatctcagccgg
gtgaaggagttcaggatcggcaccgttcccggcgaagacgaggttcgggagacgctggcg
gagatcgacagggcgctggaggatattcgcgaacgcgccgcggtccgcggagagccggga
agcgatcggacactcctgcaggtggtggtcgggacgtacaacgccgccttcgcggcggga
caaaccgaactggtgaaccatctgctggcctgcgaaggggtgcgggtgacggcggcggcg
ctccgcaacccgtacgatttcctcgcgtttccggaggttcacgcctacgcggcctgttac
gagaacaccccctgcatgatggaggcgctggccgaagtgctggccggggagacggaggcc
cggggccgcctgccggtcaccctgtcggagcgatatccgtttgggcacggcatttcggga
tttcggaaagaacgagacggtgaagagacttga

DBGET integrated database retrieval system