KEGG   Thermobacillus composti: Theco_1703Help
Entry
Theco_1703        CDS       T02394                                 

Definition
2-oxoacid:acceptor oxidoreductase subunit gamma, pyruvate/2-ketoisovalerate family
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
tco  Thermobacillus composti
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:tco01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tco00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tco00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tco00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tco00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:tco00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:tco00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1788298..1789305)
Genome map
AA seq 335 aa AA seqDB search
MAVLPKTNELGFFEIRLESIGGLGANLAGKMLAEAGVVGSGFNGVSFSSYGSEKKGSPVK
AHIRFCAPDVHIRDTTPIERPHIVGIFHENLYKTVNVISGIYEDSIVLVNSAKSPEQLKD
KLKLLGGTIAVVDATGIALEEKNRVNMAMLGGLFRLCDFLDPEFMKGVIRKSLEKKYPQA
VEPAIRTFERGYNEVKFQTFSLAEGVEMPKPTRWDIPILGYETQPIGGTVTNPGNSILKD
LSISRAGMMPHFHEDKCIHCAACDTACPDFCFVWEEKPDKKGRPQMFLQGIDYQYCKGCL
KCVVACPTEALTAERETDGYGEEHRVPHRFALANG
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggctgtattgccgaagacgaacgagcttggtttctttgagattcgcctggaatccatc
ggcggactcggcgccaatctcgccggcaagatgctggccgaagcaggcgtcgttggaagc
ggattcaacggtgtcagtttctcatcctacggctcggagaagaaaggttcgccggtcaag
gcgcatatccgtttctgcgcgcccgatgtccatatccgggacacgactccgatcgagcgg
ccgcatatcgtcggcattttccatgagaacctgtacaagacggtcaacgtcatcagcggc
atctacgaagacagcatcgtgctggtcaactcggccaagtcgcccgaacagctcaaagac
aaactgaagctgctcggcggcacgatcgcggtcgtcgacgcgacgggcatcgcgctcgaa
gagaagaaccgcgtcaacatggcgatgctgggcggactgttcagactgtgcgatttcctc
gatcccgaattcatgaaaggcgtcattcgcaagtcgctcgagaaaaagtatccgcaagcc
gttgaaccggcgatccggacgttcgagcgcggctacaacgaagtgaaattccagacgttc
agtctggccgaaggcgtcgaaatgccgaagccgacccgctgggacattccgatcctcggg
tatgaaacgcagccgatcggcggaacggtcacgaatccgggcaacagcatcctgaaggat
ctcagcatttcccgcgcgggcatgatgccgcatttccatgaggacaaatgcatccactgc
gcggcctgcgacacggcctgccccgacttctgcttcgtctgggaagagaagcccgacaag
aagggccgtccgcagatgttcctgcagggcattgactatcagtactgcaagggctgcctg
aaatgcgtcgtcgcctgcccgaccgaagcgcttacggccgagcgggagacggacggctac
ggcgaggaacaccgcgtgccgcaccgcttcgcgctcgcgaacgggtaa

DBGET integrated database retrieval system