KEGG   Thermobacillus composti: Theco_1717Help
Entry
Theco_1717        CDS       T02394                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tco  Thermobacillus composti
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Theco_1717
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theco_1717
   00020 Citrate cycle (TCA cycle)
    Theco_1717
   00620 Pyruvate metabolism
    Theco_1717
Enzymes [BR:tco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Theco_1717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1802721..1804025)
Genome map
AA seq 434 aa AA seqDB search
MARFEYRFPELGEGLHEGEIIKINIKPGDKVTDDDIIMEVQNDKAIVEVPCPVNGTVLEV
LVKDGQVCHVGEVVAVIEAEGDVPEQAPSAGGESQGSQAPAPEASAATPGASAPSAPPAP
AAPAAAEAPKAGGLVLATPGVRKYAREKGVDLTQVTGTGKNGRITREDVDRAAAGGAAPA
APAAEAAQALPTAAAAVPAGSRVEERVPLKGIRKAIANAMVKSVYTAPHVTLMDEVDVTK
LVELRAKAKPLAEKKGVKLTYLPFIVKALVAALREYPIMNASLDEETQEIVYKKYYNIGI
ATDTDAGLIVPVVADADRKSIWMIADEIRDLAARGREGKLAPHELRGSTMTITNIGSAGG
MFFTPVINYPEVAILGTGRIAEKPIVRGGEIVAAPVLALSLSFDHRLIDGATAQNFLNYI
KQLLGDPELLVMEV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtggcaagattcgaataccggttcccggagctgggcgaaggactgcacgaaggcgagatt
atcaaaatcaacatcaagcccggcgacaaggtcaccgatgacgacatcatcatggaagtg
cagaacgacaaggcgatcgtcgaagtgccgtgcccggtgaacggcaccgtgctggaagtg
ctcgtcaaggacgggcaggtctgccatgtcggcgaagtcgtcgccgtcattgaagccgaa
ggcgacgtgccggagcaggcaccgtccgccggcggcgagtcgcaaggctcccaggcgccg
gcaccggaggcttcggcggcaacgccgggagcaagcgcgccgtcggcgccgcccgcgcct
gcggcacctgcggcggccgaagcgcccaaggcgggcggcctggtgctcgcgacgccgggc
gtacgcaaatacgcgcgcgagaaaggcgtcgatctgacgcaggtaaccggcacgggcaag
aacggccgaattacgcgcgaagacgtagaccgcgcggcggcgggcggtgcggcgccggca
gctccggctgcggaggcggctcaggccctgccgacagcagcggcggcagtaccggcggga
tctcgcgtcgaggaacgcgtgccgctcaagggcattcgcaaggcgatcgcgaacgcgatg
gtgaagtcggtctataccgcgccgcacgtgacgctgatggacgaagtcgacgtgacgaag
ctcgtcgaactgcgcgcgaaggcgaagccgctcgcggagaagaagggcgtcaagctgacg
tatctgccgttcatcgtgaaggcgctcgtcgccgcgttgcgcgagtatccgatcatgaat
gcgtcgctcgacgaagagacgcaggagatcgtctacaagaagtactacaacatcggcatc
gcgacggatacggatgccggcctgatcgtgccggtcgtcgcggacgccgaccggaagagc
atctggatgatcgcggacgagatccgcgacctggcggcgcgcggccgcgaaggcaagctc
gcgccgcatgagctgcgcggcagcacgatgacgatcacgaacatcggctcggcgggcggc
atgttcttcacgccggtcatcaactatccggaagtcgcgattctcggcacgggccgcatc
gcggagaaaccgatcgtccgcggcggggagatcgtcgccgcgccggtgctcgcactctcg
ctcagcttcgaccaccggctgatcgacggcgccacggcgcaaaatttcctgaactacatc
aagcagctcctcggcgatccggaactgctggtcatggaggtgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system