KEGG   Thermobacillus composti: Theco_1717Help
Entry
Theco_1717        CDS       T02394                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tco  Thermobacillus composti
Pathway
tco00010  Glycolysis / Gluconeogenesis
tco00020  Citrate cycle (TCA cycle)
tco00620  Pyruvate metabolism
tco01100  Metabolic pathways
tco01110  Biosynthesis of secondary metabolites
tco01120  Microbial metabolism in diverse environments
tco01130  Biosynthesis of antibiotics
tco01200  Carbon metabolism
Module
tco_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theco_1717
   00020 Citrate cycle (TCA cycle)
    Theco_1717
   00620 Pyruvate metabolism
    Theco_1717
Enzymes [BR:tco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Theco_1717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H ATP-synt_ab_Xtn RnfC_N
Motif
Other DBs
NCBI-ProteinID: AGA57849
UniProt: L0EE15
Position
complement(1802721..1804025)
Genome map
AA seq 434 aa AA seqDB search
MARFEYRFPELGEGLHEGEIIKINIKPGDKVTDDDIIMEVQNDKAIVEVPCPVNGTVLEV
LVKDGQVCHVGEVVAVIEAEGDVPEQAPSAGGESQGSQAPAPEASAATPGASAPSAPPAP
AAPAAAEAPKAGGLVLATPGVRKYAREKGVDLTQVTGTGKNGRITREDVDRAAAGGAAPA
APAAEAAQALPTAAAAVPAGSRVEERVPLKGIRKAIANAMVKSVYTAPHVTLMDEVDVTK
LVELRAKAKPLAEKKGVKLTYLPFIVKALVAALREYPIMNASLDEETQEIVYKKYYNIGI
ATDTDAGLIVPVVADADRKSIWMIADEIRDLAARGREGKLAPHELRGSTMTITNIGSAGG
MFFTPVINYPEVAILGTGRIAEKPIVRGGEIVAAPVLALSLSFDHRLIDGATAQNFLNYI
KQLLGDPELLVMEV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtggcaagattcgaataccggttcccggagctgggcgaaggactgcacgaaggcgagatt
atcaaaatcaacatcaagcccggcgacaaggtcaccgatgacgacatcatcatggaagtg
cagaacgacaaggcgatcgtcgaagtgccgtgcccggtgaacggcaccgtgctggaagtg
ctcgtcaaggacgggcaggtctgccatgtcggcgaagtcgtcgccgtcattgaagccgaa
ggcgacgtgccggagcaggcaccgtccgccggcggcgagtcgcaaggctcccaggcgccg
gcaccggaggcttcggcggcaacgccgggagcaagcgcgccgtcggcgccgcccgcgcct
gcggcacctgcggcggccgaagcgcccaaggcgggcggcctggtgctcgcgacgccgggc
gtacgcaaatacgcgcgcgagaaaggcgtcgatctgacgcaggtaaccggcacgggcaag
aacggccgaattacgcgcgaagacgtagaccgcgcggcggcgggcggtgcggcgccggca
gctccggctgcggaggcggctcaggccctgccgacagcagcggcggcagtaccggcggga
tctcgcgtcgaggaacgcgtgccgctcaagggcattcgcaaggcgatcgcgaacgcgatg
gtgaagtcggtctataccgcgccgcacgtgacgctgatggacgaagtcgacgtgacgaag
ctcgtcgaactgcgcgcgaaggcgaagccgctcgcggagaagaagggcgtcaagctgacg
tatctgccgttcatcgtgaaggcgctcgtcgccgcgttgcgcgagtatccgatcatgaat
gcgtcgctcgacgaagagacgcaggagatcgtctacaagaagtactacaacatcggcatc
gcgacggatacggatgccggcctgatcgtgccggtcgtcgcggacgccgaccggaagagc
atctggatgatcgcggacgagatccgcgacctggcggcgcgcggccgcgaaggcaagctc
gcgccgcatgagctgcgcggcagcacgatgacgatcacgaacatcggctcggcgggcggc
atgttcttcacgccggtcatcaactatccggaagtcgcgattctcggcacgggccgcatc
gcggagaaaccgatcgtccgcggcggggagatcgtcgccgcgccggtgctcgcactctcg
ctcagcttcgaccaccggctgatcgacggcgccacggcgcaaaatttcctgaactacatc
aagcagctcctcggcgatccggaactgctggtcatggaggtgtaa

DBGET integrated database retrieval system