KEGG   Thermobacillus composti: Theco_1743Help
Entry
Theco_1743        CDS       T02394                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
tco  Thermobacillus composti
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:tco00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1830749..1831291
Genome map
AA seq 180 aa AA seqDB search
MAEIRIRNTNERITGEENVREFLNGQGVLYEHWDTSKLPEHLREKFVLSDEEKNEILQAY
DAEIRDLAGRRGYQTWDVISLSDATPNLDELLKKFEQVHTHTEDEVRAIVAGKGIFIIKG
KPEVGYFDVELEAGDVISVPEGNPHYFTLMENRQIVAVRLFIEPAGWVAHPYEDPEFQKA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggccgagattcgcatccgcaacaccaacgagagaatcaccggagaggagaatgtgcgc
gaatttctgaatggacaaggtgtcctctacgagcactgggatacgtccaaactgccggag
catctgcgggaaaaattcgtgctgagcgatgaggagaagaacgaaatcctccaggcgtat
gacgcggagatccgcgatctcgccggccggcgcggctatcagacttgggacgtcatttcc
ctgtccgacgctacgccgaacctggatgagttgttgaagaaattcgaacaagtgcatacg
cacaccgaggacgaagtccgcgccatcgtggcaggcaaaggcatcttcatcatcaagggc
aagccggaagtcggctacttcgacgtcgagctggaagcaggtgatgtcatctccgttccg
gaaggcaatccgcactacttcacgctgatggaaaaccgtcagatcgtcgccgtgcgtctg
ttcatcgagccggcgggctgggtcgcccatccgtacgaagatccggaattccaaaaagca
taa

DBGET integrated database retrieval system