KEGG   Thermobacillus composti: Theco_1843Help
Entry
Theco_1843        CDS       T02394                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tco  Thermobacillus composti
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tco01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:tco00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1938859..1939653)
Genome map
AA seq 264 aa AA seqDB search
MYLDRIVAVKRGEVEELKAQLNPAEAERRIAALPPCRGFRRALAEGRRREIGLIAEVKKA
SPSKGLIREDFHPVGLARSYEAAGADCLSVLTDRQFFQGANDYLTRIRDAVSLPLLRKDF
TIDPLQIYEARLIGADAILLIAAILTPDELKTYYRLAKDLGMDALVEVHDRREMETVLDL
GIAELVGINNRDLRTFVTDLKTTEELARLVPDDATLVSESGISSPDDIRRVREAGARAVL
IGEHFMRQPDVGEAVLALMEPIAR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtatcttgatcgcatcgttgccgtgaagcgcggcgaggttgaggaattgaaggcgcag
ctgaatccggccgaagcggagcgtcgcatcgcggcgctgccgccttgccgcggcttcagg
cgcgcgcttgcggaaggccggcggcgggaaatcggcctgatcgcggaagtgaagaaagca
tcgccgtcgaaggggctgatccgcgaagatttccatccggtcgggctcgcccgcagctac
gaggcggcgggcgcggattgtctgtccgttctgacggaccgccaattcttccagggggcg
aacgactatctgacccggatccgcgatgccgtcagcctgccgctgctgcgcaaagatttc
accatcgatccgctgcagatctacgaagcgcggctgatcggcgcggacgccatcctgctc
atcgcggcgatcctgacgccggacgagctcaagacttattaccggcttgcgaaggacctc
ggcatggatgcgctggtggaagttcacgaccggcgggagatggaaacggtactggacctc
ggcatcgcggagctcgtcggcatcaacaaccgcgatctgcgcacgttcgtgacggatctg
aagacgacggaagagctggcccggctcgtgccggatgacgcgacgctcgtcagcgagagc
ggcatttcgtcgccggacgacatccggcgggtgcgggaagcgggggcgcgcgccgtgctg
atcggcgagcatttcatgcgccagccggatgtcggcgaagcggtcctcgcgctgatggag
ccgatcgcgcgatga

DBGET integrated database retrieval system