KEGG   Thermobacillus composti: Theco_1843Help
Entry
Theco_1843        CDS       T02394                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tco  Thermobacillus composti
Pathway
tco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tco01100  Metabolic pathways
tco01110  Biosynthesis of secondary metabolites
tco01130  Biosynthesis of antibiotics
tco01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tco00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Theco_1843
Enzymes [BR:tco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Theco_1843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh His_biosynth
Motif
Other DBs
NCBI-ProteinID: AGA57974
UniProt: L0EEC9
Position
complement(1938859..1939653)
Genome map
AA seq 264 aa AA seqDB search
MYLDRIVAVKRGEVEELKAQLNPAEAERRIAALPPCRGFRRALAEGRRREIGLIAEVKKA
SPSKGLIREDFHPVGLARSYEAAGADCLSVLTDRQFFQGANDYLTRIRDAVSLPLLRKDF
TIDPLQIYEARLIGADAILLIAAILTPDELKTYYRLAKDLGMDALVEVHDRREMETVLDL
GIAELVGINNRDLRTFVTDLKTTEELARLVPDDATLVSESGISSPDDIRRVREAGARAVL
IGEHFMRQPDVGEAVLALMEPIAR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtatcttgatcgcatcgttgccgtgaagcgcggcgaggttgaggaattgaaggcgcag
ctgaatccggccgaagcggagcgtcgcatcgcggcgctgccgccttgccgcggcttcagg
cgcgcgcttgcggaaggccggcggcgggaaatcggcctgatcgcggaagtgaagaaagca
tcgccgtcgaaggggctgatccgcgaagatttccatccggtcgggctcgcccgcagctac
gaggcggcgggcgcggattgtctgtccgttctgacggaccgccaattcttccagggggcg
aacgactatctgacccggatccgcgatgccgtcagcctgccgctgctgcgcaaagatttc
accatcgatccgctgcagatctacgaagcgcggctgatcggcgcggacgccatcctgctc
atcgcggcgatcctgacgccggacgagctcaagacttattaccggcttgcgaaggacctc
ggcatggatgcgctggtggaagttcacgaccggcgggagatggaaacggtactggacctc
ggcatcgcggagctcgtcggcatcaacaaccgcgatctgcgcacgttcgtgacggatctg
aagacgacggaagagctggcccggctcgtgccggatgacgcgacgctcgtcagcgagagc
ggcatttcgtcgccggacgacatccggcgggtgcgggaagcgggggcgcgcgccgtgctg
atcggcgagcatttcatgcgccagccggatgtcggcgaagcggtcctcgcgctgatggag
ccgatcgcgcgatga

DBGET integrated database retrieval system