KEGG   Thermobacillus composti: Theco_2082Help
Entry
Theco_2082        CDS       T02394                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
tco  Thermobacillus composti
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:tco00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Theco_2082
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Theco_2082
Enzymes [BR:tco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Theco_2082
Two-component system [BR:tco02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Theco_2082
Bacterial motility proteins [BR:tco02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Theco_2082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2166857..2168128)
Genome map
AA seq 423 aa AA seqDB search
MKRYRIIVVDDSAFMRKLFSDIIESDPAFTVIAVGKNGREAVELHRDLKPDAITIDLEMP
EMNGIEALKHIMAEASTPVIMLSGISEEHTRETIAALALGAFDFIRKPSGPGADIRKTAE
ELMLRLKAAAAIRRQAAPEAKERPEASRPAAKTKGAARAAPVPKQPKEPKQPKELKQPKR
PEQPPAKRESAAPSPSPASESPRIPDSGIRPEAVRPAPPAPAKPVAAETAGAFRHIIAIG
TSTGGPRALHRLLSELPGDLPAPLLIVQHMPPKFTYSLAQRLNSHSALTVKEAEDGEPVR
PGFAYIAPGGRHMELAASGRQYVIRLTDGPQRNGHRPSVDVLFESLVPFTELARHAVILT
GMGSDGAKGMRALADHGAVTTIAEAEETCVVFGMPRSAIEEGAASIVLPLHDIPARLTEA
VRR
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgttaccggatcatcgtcgtagacgactcggccttcatgaggaaactgttctcg
gacatcattgaatccgatccggcgttcaccgtcatcgccgtcgggaagaacggcagggag
gcggtggagcttcatcgagatctgaagccggacgccattacgatcgacctggaaatgccg
gagatgaacgggatcgaagcgctgaagcacattatggccgaagcaagcacgcccgtcatc
atgctgtccggcatcagcgaggagcatacccgggagacgatcgcggcgctcgcactcggc
gcgttcgattttatccgcaaaccttccggaccgggcgcggatattcgcaagacggctgaa
gagctcatgcttcggctgaaagcggcggcagcgatccgccggcaggcggctcccgaagcg
aaagaacgtccggaggccagccgtccggccgcgaagacgaaaggcgctgcccgggcggca
cccgtgccgaagcagccaaaggagccgaagcagccaaaggagctgaagcagccgaagcgg
ccggagcagccgccggcgaagcgggagagcgcggcaccgtctccgtcgcccgcatcggaa
tctccgcggattccggattccggaatccggccggaagccgtccggcctgcgcctcctgcg
cctgcgaagccggttgccgcggaaacggcgggcgcgttccggcatatcatcgcgatcgga
acgtcgaccggcggcccaagggcgctgcatcgtctgctcagcgagctgccgggcgacctg
cccgcaccgcttctgatcgtgcagcatatgccgccgaagttcacctactcgcttgcgcag
cggctgaacagccattccgccctgacggtcaaggaagcggaagacggcgaaccggttcgg
ccgggcttcgcatatatcgcgcccggcgggcgccatatggagctcgcggcaagcggccgt
cagtatgtcattcgactgacggacgggccgcagcggaacggtcaccgcccgtcggttgat
gtgttgttcgaatcgcttgtacctttcaccgaactagcccgtcacgccgtcatcttgacg
ggcatgggcagcgacggagccaaaggcatgcgggcacttgcggatcacggcgccgtcacg
accatagccgaagcggaggagacatgcgtcgtattcggcatgccgcgctccgcaatcgaa
gaaggcgccgcctcgatcgtgctgccgctgcacgacataccggctcggctgaccgaggcc
gtcaggcgatag

DBGET integrated database retrieval system