KEGG   Thermobacillus composti: Theco_2520Help
Entry
Theco_2520        CDS       T02394                                 

Definition
(GenBank) Holliday junction DNA helicase, RuvA subunit
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tco  Thermobacillus composti
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tco00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Theco_2520
Enzymes [BR:tco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Theco_2520
DNA repair and recombination proteins [BR:tco03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Theco_2520
    RecFOR pathway proteins
     Theco_2520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2625211..2625840)
Genome map
AA seq 209 aa AA seqDB search
MIDYIRGPVAHIEEEWIVVDVAGVGYRVFTPNPYAFAVSGEPVTVYTHHHVREDAALLFG
FATREEQRLFRALLEVSGIGPKVALGVLAGARPEAIAAAIRQENVAFLTKLPGIGRKTAQ
RMILDLKDKLDRGTGIGPASGMDDLPAEPAAAGGQGAGTAWPEAREALAALGYTAAEIDR
VWQTISGSVSGEETADALVKRALTLLFRG
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatcgactacatacggggacccgtcgcgcacatcgaagaggaatggatcgtcgtcgac
gtcgcgggcgtcgggtaccgcgttttcacaccgaatccttatgcgttcgcggtatccggc
gagccggtgaccgtctatacgcatcatcatgtgcgcgaggatgccgcgctgctgttcggc
ttcgcgacgcgcgaggagcagcggctgttccgggcgctgctcgaggtgtccggcatcgga
ccgaaggtcgcgctcggcgtcctggcgggcgcgcgtccggaagcgatcgcggccgccatc
cggcaggagaacgtcgcgtttctgaccaagctgccgggcatcgggcgcaagaccgcccag
cggatgattctggacctgaaggacaagctggaccgcggcaccggcatcggacccgcgtcc
ggcatggacgatctgcccgcggaaccggccgcggctggcggccagggcgcgggcaccgcc
tggccggaggcgcgcgaagcgctggccgcgctcggctatacggcggcggagatcgaccgc
gtatggcagacgatcagcggttcggtgagcggagaggagacggcggacgccctcgtgaag
cgggcgctgacgctgctcttcagaggttga

DBGET integrated database retrieval system