KEGG   Thermobacillus composti: Theco_3183Help
Entry
Theco_3183        CDS       T02394                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tco  Thermobacillus composti
Pathway
tco00040  Pentose and glucuronate interconversions
tco00052  Galactose metabolism
tco00500  Starch and sucrose metabolism
tco00520  Amino sugar and nucleotide sugar metabolism
tco01100  Metabolic pathways
tco01130  Biosynthesis of antibiotics
Module
tco_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tco00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Theco_3183
   00052 Galactose metabolism
    Theco_3183
   00500 Starch and sucrose metabolism
    Theco_3183
   00520 Amino sugar and nucleotide sugar metabolism
    Theco_3183
Enzymes [BR:tco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Theco_3183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD Glycos_transf_2 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AGA59238
UniProt: L0EG40
Position
complement(3349785..3350672)
Genome map
AA seq 295 aa AA seqDB search
MSVKKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVASGIEDIIIVTGKGK
RAIEDHFDNSFELEYNLLEKGKLDLLSEVQKPSQMADIHYIRQKEPRGLGHAVWCARKFI
GNEPFAVLLGDDIVRAERPALRQLMDQHDRYRSSVIGVKPVADNEVHRYGIVDGKPIDHG
FYSVAGLVEKPSQGSAPSNLAIMGRYILSPTIFDILGSLEPGAGGEIQLTDAIAKLNETE
AVYAFEFEGTRYDVGEKMGFIRTTVEFALQREDLRESLLDYLTRLQQEQLHPQAR
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcaagaaagcgatcattccggctgcaggactcggcacgcgttttctgcccgcg
acgaaagcgatgccgaaggagatgctgcccatcgtcgacaagccgaccatccagtacatc
gtcgaggaagcggtggcgtcgggcatcgaggacatcattattgtgacggggaagggcaag
cgggcgatcgaggaccatttcgacaactccttcgagctggagtacaacctgctggagaag
ggcaagctcgacctgctcagcgaggtgcagaagccttcgcagatggcggacatccactac
atccggcagaaggagccccgcggactcggccacgccgtctggtgcgcccgcaaattcatc
ggcaacgagccgttcgccgtgctgctcggggacgacatcgtgcgcgccgaacgcccggcg
ctgcgccagctgatggatcagcatgaccggtaccgttcgtcggtcatcggcgtgaagccc
gtggcggacaacgaggtgcaccgctacggcatcgtggacggcaagccgatcgaccacggc
ttctacagcgtggccgggctggtggagaagccgtcccaggggtccgcgccgtcgaatctt
gccatcatggggcggtatattctgagcccgacgatcttcgacattctgggcagcctggag
cccggcgccggcggcgagatccagctgaccgacgcgatcgcgaagttgaacgagacggaa
gcggtgtacgcgttcgagttcgaaggcacccgctacgacgtcggcgagaaaatggggttc
atccgcaccacggtcgagttcgcgctgcagcgcgaagatcttcgcgagagtctgctcgac
tatctgacgcggctgcagcaggaacagctgcatccccaggcgcggtga

DBGET integrated database retrieval system