KEGG   Thermobacillus composti: Theco_3245Help
Entry
Theco_3245        CDS       T02394                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tco  Thermobacillus composti
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tco00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Theco_3245
   00052 Galactose metabolism
    Theco_3245
   00500 Starch and sucrose metabolism
    Theco_3245
   00520 Amino sugar and nucleotide sugar metabolism
    Theco_3245
Enzymes [BR:tco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Theco_3245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3427089..3427967)
Genome map
AA seq 292 aa AA seqDB search
MTRTRIRKAVLPAGGLGTRFLPATKAQPKEMLPLIDKPAIQYIVEEAVKSGIESIMIVTG
RNKRAIEDHFDKSVELEMALKAKGDGEMLDIVRGISNLAEIYYIRQKEPLGLGHAVLSAR
HFVENEPFAVLLGDDILVSDPPCLRSMIDVYEQTGSSVVAVMQVPWEETEKYGIADFDAE
SGDHRIRSLVEKPPRGEAPSNWAVVGRYIFTPDIFRYLEKAAPGRGGEIQLTDSMQQLNA
ESPMIAYPFRGRRYDIGDKFGFVQATVDLALDRPDLAERVRAYLRQRLSGHE
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgaccagaacccgcatccgcaaggcggttcttccggcgggaggactcggcacgcgattc
ctgccggcgacgaaggcgcagccgaaggaaatgctgccgctgatcgacaagccggcgatc
cagtatattgtcgaagaagcggtgaagtccggcatcgagagcatcatgatcgtcacgggc
cggaacaagcgggcgatcgaggaccatttcgacaaatcggtcgagctggagatggcgctg
aaggcgaagggcgacggggaaatgctggacatcgtccgcggcatttcgaatctggcggag
atctattacatccggcagaaggagccgctcgggctcgggcacgccgtcctcagtgcgcgg
catttcgtcgagaacgagccgttcgcggtgctgctcggcgacgatattctcgtctcggat
ccgccgtgcctccggtcgatgatcgacgtgtacgagcagaccggctcgtccgtcgtcgcc
gtcatgcaggtgccgtgggaggagacggagaaatacggcatcgccgatttcgatgccgaa
tccggcgaccatcgcatccgcagtctggtcgagaagccgccgcgcggcgaggcgccttcc
aactgggcggtcgtcgggcggtatattttcacgccggacatcttccgctatctggagaag
gccgcgcccggccgcgggggcgagattcagctgacggacagcatgcagcagttgaacgcg
gagtcgccgatgatcgcctatccgttccgcggccggcggtacgacatcggcgacaaattc
ggcttcgtgcaggcgaccgtcgatctggcgctcgaccggccggatctggcggagcgggtc
agggcgtatttgcggcagcggctgagcgggcacgaataa

DBGET integrated database retrieval system