KEGG   Thermobacillus composti: Theco_3531Help
Entry
Theco_3531        CDS       T02394                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tco  Thermobacillus composti
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tco03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3752443..3753039)
Genome map
AA seq 198 aa AA seqDB search
MYYPEPIAKLIDSFSRLPGIGPKTAARLAFHVLRMSEDDVVSFAKALVSVKRNLHYCSIC
CNITDVDPCRICQDKTRDPSVICVVQEPKDLVAMERTKEYDGQYHVLQGAISPMDGIGPD
EIRIAELLKRLTDDRVKEMILATNPNIEGEATAMYLSRLVKPFGIKVTRIAHGLPVGGDL
EYADEVTLSKALEGRREL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttgtactatccggaaccgatcgcgaagctgatcgattcgttctcccggctgccgggcatc
ggtccgaagaccgccgcccgccttgcctttcatgtgctgcgcatgagcgaggatgacgtc
gtctcattcgccaaggcgctggtcagcgtcaaacgcaacctgcattactgctccatctgc
tgcaacatcaccgacgtggatccttgtcgcatctgccaggacaagacgcgcgatccgtcc
gtcatctgcgtcgtccaggagccgaaggatctcgtcgccatggagcggacgaaggagtac
gacggtcaataccatgtgctgcagggagccatttcgccgatggacggcatcggcccggac
gagatccgcattgccgaactgctgaagcggctgaccgacgatcgggtgaaagaaatgatt
ctggcgaccaatccgaacatcgaaggcgaagcgacggcgatgtacctgtcccgcctggtc
aaaccgttcggcatcaaggtgacgcgcatcgcgcacgggctgccggtcggcggagacctg
gagtatgcggacgaagtcaccctgtccaaggcgctagaaggacgaagagagttgtga

DBGET integrated database retrieval system