KEGG   Thermobacillus composti: Theco_3560Help
Entry
Theco_3560        CDS       T02394                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
tco  Thermobacillus composti
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:tco00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3781662..3782531)
Genome map
AA seq 289 aa AA seqDB search
MKLDQKYSGNVFILSSEDYESAKAVIYGMPMDFTVSFRPGSRFGPPRIREASVGLEEYSP
YLDRSLEDIVYFDAGDLLLPFGNAARSLEMIGEFVRGVLADGKLPVGLGGEHLVSWPIIR
EVYAKYPDLAVIHIDAHADLREQYEGEPLSHSTPIRKVAELIGGKNVYQFGIRSGSREEW
AYGRENVNFHPFEVLEPLKRALPELAGRPVYVTIDIDVLDPSCAPGTGTAEAGGITSKEL
LDAVHAIARSDARVVGCDLVEVAPAYDPTEQTQIAASKIVREMLLGFVK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctggatcaaaaatattccggcaacgtgttcattctgagctccgaagattacgaa
tcggcgaaggcggtcatctacggcatgccgatggacttcaccgtctcgttccgcccgggc
tcgcgcttcggcccgccgcgcatccgcgaggcgtcggttggcctggaagagtacagcccg
tatctggaccgcagcctcgaagacatcgtctatttcgatgcgggggatctgctcctgccg
ttcggcaatgcggcgcgcagcctggagatgatcggcgaattcgtgcggggcgttctggcg
gacgggaagctgccggtcggcctcggcggcgagcacctcgtctcgtggccgatcatccgc
gaagtctacgcgaagtatccggatctggcggtcatccatatcgacgcgcacgcggacctg
cgcgagcagtacgaaggcgagccgctgtcgcactcgacgccgatccgcaaagtcgcggag
ctcatcggcgggaagaacgtgtaccagttcggcatccgctccggctcgcgcgaggagtgg
gcgtacggacgggagaacgtgaacttccatccgttcgaagtgctggagccgctgaagcgc
gcgctgcccgagctggcgggccggcccgtgtacgtgacgatcgacatcgacgtgctcgat
ccgtcctgcgcgcccggcaccggcacggccgaagcgggcggcatcacgtcgaaggagctg
ctggatgccgtgcatgcgatcgcgcgctccgacgcgcgggtcgtcggctgcgacctggtg
gaagtggcgcccgcctacgatccgacggagcagacgcaaatcgccgcttcgaagatcgtg
cgggagatgctgctcggtttcgtgaaataa

DBGET integrated database retrieval system