KEGG   Thermobacillus composti: Theco_3713Help
Entry
Theco_3713        CDS       T02394                                 

Definition
alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
tco  Thermobacillus composti
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tco00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Theco_3713
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theco_3713
   00620 Pyruvate metabolism
    Theco_3713
   00650 Butanoate metabolism
    Theco_3713
  Lipid metabolism
   00071 Fatty acid degradation
    Theco_3713
  Amino acid metabolism
   00350 Tyrosine metabolism
    Theco_3713
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Theco_3713
   00626 Naphthalene degradation
    Theco_3713
Enzymes [BR:tco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Theco_3713
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Theco_3713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3937348..3940080
Genome map
AA seq 910 aa AA seqDB search
MAETVLHREPVDSAEKLERALGRLRKAQALFASYTQEQVDHIFLAAATAANKARIPLAKM
AADETGMGVVEDKVIKNHYASEYIYNAYRDVKTCGVLEEDPAYGIKKIAEPVGIVAAVIP
TTNPTSTAIFKCLLALKTRNGILVSPHPRAKNCTIAAAKIVLDAAVEAGAPEGIIDWIDA
PSLELTNLLMKEADLILATGGPGMVKAAYSSGKPAVGVGAGNTPAVIDDSADIRLAVNSI
IHSKTFDNGMICASEQAVIVLDGIYDRVKKEFADRGCCFLDPDETEKVRKTLFINGVLNA
GIVGQPAHRIAEIAGVKAPEAAKILIGEVERTDPSEEFAREKLSPVLAMYRAKDFADALD
KAERLVADGGMGHTAAIYLDPVGARDKLDAFTARMKTCRILVNTPSSQGGIGDLYNFRLA
PSLTLGCGSWGGNSVSENVGVKHLLNIKTVAERRENMLWFRAPQKVYIKRGCLPVALDEL
KTVMGKKRAFIVTDHFLYKNGLTKPVTDKLDELGIAHATFFEVEPDPTLACAQEGARQMA
AFEPDVIIAVGGGSPMDAAKIMWVLYDHPDADFMDMAMRFMDIRKRVYRFPPMGRKAAFV
AVPTTAGTGSEVTPFAVITDEKTGIKYPLADYELMPHMAIVDADLMMHMPKGLTTASGID
ALTHSLEAYVSMMATDYTDGLALRAIKLIFDYLPRAYEKGAGDPAAREKMADAATIAGMA
FANAFLGICHSLAHKLGAAFRLPHGIANALLITEVMRYNAAEAPTKMGTFPQYDHPRTLR
RYAEIAEFLNLPGATDEEKLESLIRKIEELKEKLGIKKTIRDYGIDEEEFLEKLDDLAEQ
AFDDQCTGTNPRYPLFAELKQLYLNAYYGTHEGAANRAAGGHAAGAAERAAAGRPAKDAC
AGIVRREGGE
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaccgttttgcaccgggaacccgtcgacagcgcggaaaagctggaacgggcg
cttggccggctgagaaaggcgcaggccctttttgcctcctacacgcaggagcaggtggac
cacatcttcctcgccgccgccaccgcggccaacaaggcgcgcatcccgctggcgaaaatg
gccgcggatgagacgggaatgggcgtcgtcgaagacaaagtcatcaagaaccattacgcc
tccgaatacatctacaacgcctaccgcgacgtgaaaacgtgcggcgtcctggaggaagat
cccgcctacggcatcaaaaagatcgccgagcccgtcggcatcgtcgccgcggtcatcccg
acgaccaacccgacgtcgacggccatcttcaaatgcctgttggcgctgaagacgcgcaac
ggcatcctcgtcagcccgcacccccgggcgaaaaactgcaccatcgcggccgcgaaaatc
gtgctggacgcggcggtggaagcgggcgccccggaaggcatcatcgactggatcgacgcc
ccttcgctggaactgaccaacctgctcatgaaggaagcggatctcatccttgccaccggc
ggcccgggcatggtgaaggcggcctattccagcggcaagcccgccgtcggcgtcggcgcg
ggcaacacgccggccgtcatcgacgacagcgccgacatcaggctcgccgtgaactccatc
atccattccaaaacgttcgacaacggcatgatttgcgcttcggagcaggcggtcatcgtg
ctggacggcatttatgacagggtgaaaaaagaatttgccgaccgcggctgctgcttcctg
gatccggacgaaacggagaaggtgcgcaaaacactcttcatcaacggcgtcctcaacgcc
ggaatcgtcggacagccggcgcaccggatcgccgaaatagccggcgtgaaggcgccggaa
gcggccaaaatcctgatcggcgaagtggagcgcaccgatccgtccgaggagttcgcccga
gagaaactgtcgcccgtcctcgccatgtaccgcgcgaaggatttcgccgacgccctggac
aaagcggagcggcttgtcgccgacggcggcatgggccacaccgcggcgatctatctcgac
ccggtcggcgcgcgggacaaactggacgccttcaccgcccgcatgaagacgtgccgcatc
ctggtcaacacgccgtcgtcccagggcggcatcggagacctgtacaacttcaggctggcg
ccctccctcaccctcggctgcggttcctggggcggcaactccgtcagcgagaacgtcggg
gtcaagcatctgctcaacatcaaaaccgtcgccgaaaggagagaaaacatgctctggttc
cgggcgccgcagaaagtgtacatcaaacggggatgtcttcccgtcgcccttgacgaactg
aagaccgtcatggggaaaaagcgggcgttcatcgtcaccgaccatttcctttacaaaaac
ggtctgacgaaaccggtcaccgacaaactggatgaactcggcatcgcccacgccaccttc
ttcgaggtcgagcccgacccgacactggcctgcgcgcaggaaggcgcaagacaaatggcc
gccttcgaaccggacgtcatcatcgccgtcggcggcggttcgccgatggacgcggcgaaa
atcatgtgggtgctgtacgatcatccggacgccgacttcatggacatggcgatgcggttc
atggacatccgcaagcgggtgtaccggtttccgccgatgggccggaaagccgcattcgtc
gccgttccgacgacggcgggcaccggttctgaagtgacgccgtttgccgtcatcaccgac
gagaagacgggcatcaaatatccgctggcggactacgagctgatgccccacatggccatc
gtcgacgcggacctgatgatgcacatgccgaaaggcctgacaaccgcttccggcatcgac
gccctcacccactcgctggaggcgtacgtctccatgatggcgaccgactacaccgacggc
ctggcgctcagggcgatcaagctgatcttcgactacctgccccgcgcgtacgagaagggc
gccggcgatccggccgcccgggagaaaatggccgacgccgccaccatcgccggcatggcg
ttcgccaacgccttcctcggcatctgccattcgctggcccacaagctcggcgcggcgttc
cgtctgccccacggcattgcgaacgcgctcctcatcaccgaagtgatgcgctacaacgcc
gccgaggcgccaaccaagatggggacgttcccgcaatacgaccatccgcgcacgctcagg
cgctacgccgaaatcgcggaatttttgaacctgccgggcgccaccgacgaagagaagctg
gaaagcctgatccgcaaaatcgaggagctgaaggaaaaactcggcatcaagaaaacgatc
cgcgactacggcatcgacgaggaagaattcctggaaaagctggacgacctggccgagcag
gccttcgacgaccaatgcacgggcacgaacccgcgctaccccctcttcgccgaactgaaa
cagctgtacctgaacgcctactacggcacgcatgaaggtgcggcaaaccgggcagccgga
gggcatgcggccggcgcggccgaacgcgcggccgccggcagaccggcaaaagacgcctgc
gccggaatcgtccgccgggaaggaggtgagtga

DBGET integrated database retrieval system