KEGG   Thermobacillus composti: Theco_3725Help
Entry
Theco_3725        CDS       T02394                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tco  Thermobacillus composti
Pathway
tco00900  Terpenoid backbone biosynthesis
tco01100  Metabolic pathways
tco01110  Biosynthesis of secondary metabolites
tco01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tco00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Theco_3725
Enzymes [BR:tco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Theco_3725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AGA59744
UniProt: L0EJC7
Position
complement(3951617..3952471)
Genome map
AA seq 284 aa AA seqDB search
MKIYEKAPAKINLLLDVLGKREDGYHEIEMVMTMVDLADRLEMEELPRDAIVLSSQAGYI
PLDEKNLAFQAARLIKDRYGVKKGVYIHLDKHIPAAAGLAGGSSDAAAALRGLNRLWQLN
LSDAELLELAAELGSDVPYCVRGGTAIARGRGEKLEQLPSPPQCWVILAKPQLNVSTADV
YGQFRLEKVKQHPSLERMVKAIEAGSFRDMCAELGNVLETVTLERHPEVRRLKEIMQRLG
ADGVLMSGSGPTVFGLVAKEAKVPRIYNGLRGFCKDVFVARMLT
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatttacgagaaagcgccggccaagatcaatctgctgctcgacgtgctgggcaag
cgggaagacggctatcacgaaatcgaaatggtcatgacgatggtcgacctggccgatcgg
ctcgaaatggaggaattgccccgggatgcgatcgtgctgtcaagccaggccggatacatc
ccgctggacgagaaaaatttggcgttccaggcggcgagattgatcaaggaccggtacggc
gtgaagaaaggcgtctacatccatctggacaaacacattccggcggctgcgggactggcc
ggcggcagcagcgacgcggcggccgcgctccgcgggctgaaccggctctggcagctgaat
ctgtccgacgccgagctcctcgagctggcggccgagctcggctccgacgtgccgtattgc
gtgcgcggcggcaccgcgatcgcgcgcgggcggggcgagaagctcgaacagctgccgagt
ccaccgcaatgctgggtcattctggcgaagccgcagctcaacgtgtcgacggccgacgtg
tacgggcagtttcggctggagaaggtgaagcagcatccgtcgctcgaacggatggtcaaa
gcgatcgaggccggctcgttccgcgacatgtgcgccgagctcggcaacgtgctcgagacg
gtgacgctcgagcgccatcccgaagtgcgccggctgaaggagatcatgcagcggctcggg
gcggacggcgtgctgatgtcggggagcggccccacggtgttcggcctggtggcgaaggaa
gcgaaggtgccgcgcatttacaacgggctccgcggattctgcaaggacgtgttcgtggca
agaatgctgacataa

DBGET integrated database retrieval system