KEGG   Thermobacillus composti: Theco_3904Help
Entry
Theco_3904        CDS       T02394                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
tco  Thermobacillus composti
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:tco00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:tco00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4137239..4137796)
Genome map
AA seq 185 aa AA seqDB search
MKVTDTRIPGLKLIEPAVFGDARGFFLESYNAARFREAGLNHVYVQDNHSLSVDAGVLRG
LHYQLNPKAQTKLVRVTAGAVYDVVVDIRRGSPTYGQWQSFILSASNKRHLLVPKGCAHG
FCTLVPNTEVQYKVDEFYSPEHDRGIAWNDPTLGIDWPVSAPILSEKDSKHPPLAEADNN
FVYEG
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtaacggatacacggatccccgggctgaagctgatcgaaccggccgtcttcgga
gacgcccggggtttttttctggaaagctacaatgcggcccgattccgcgaagcggggctg
aatcacgtctacgtgcaggacaaccattcgttgtcggtcgatgcgggcgtactgcgcgga
ctgcattatcaactgaaccccaaggcgcagacgaagctggtgcgcgtgacggcgggagcc
gtctacgatgtcgtggtggatatccgtcgtggttcgccgacttacggtcaatggcagtca
ttcattctgagcgcgtccaacaaaaggcatctgctggttccgaagggttgtgcccacggg
ttctgcacactggtgccgaacaccgaggtgcaatacaaggtcgatgaattttactcgccc
gaacacgaccggggcatcgcatggaacgatcccacgctcggcatcgattggccggtatcc
gcgccgatcctgtccgagaaagacagcaagcatcctccgcttgccgaagccgacaacaat
ttcgtgtacgaagggtga

DBGET integrated database retrieval system