KEGG   Trypanosoma cruzi: 458759.10Help
Entry
458759.10         CDS       T01012                                 

Definition
profilin
Orthology
K05759  
profilin
Organism
tcr  Trypanosoma cruzi
Brite
Exosome [BR:tcr04147]
 Exosomal proteins
  Proteins found in most exosomes
   458759.10
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 150 aa AA seqDB search
MSWQAYIDDSLIGSGHMHSAAIVGLSDGSYWGYGGNYIPQPDEVAHILKCLGNFSLVQSS
GVTIYGVKFFGLQSGEEGEMKYIFFKKGAAGGCIYTSKQTAIIAVYGNPGTSSSLQQDLE
KKEGAEIAVNPADCNSTVKRIAEYLISLDY
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcaggcgtatatcgatgacagccttatcggcagtggacacatgcacagtgcg
gcgattgttggtctttccgacgggagttactggggttatggaggaaactatatcccacag
cctgatgaggttgcccatatattgaagtgcctgggaaatttttcactcgtgcagtcctcc
ggcgtgactatttatggtgtgaagttttttggccttcagtctggtgaagaaggcgaaatg
aaatacatttttttcaaaaagggtgcggcgggtggatgcatctatacgtcaaaacagacg
gctattattgcagtttacgggaatcccggaacttcttcgtctcttcaacaagatcttgaa
aagaaggagggggcagaaattgcagtcaatcctgccgattgcaactccaccgtgaaacgg
atcgctgagtatcttatcagtttagattactaa

DBGET integrated database retrieval system