KEGG   Trypanosoma cruzi: 481435.9Help
Entry
481435.9          CDS       T01012                                 

Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
tcr  Trypanosoma cruzi
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    481435.9
Exosome [BR:tcr04147]
 Exosomal proteins
  Proteins found in most exosomes
   481435.9
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 516 aa AA seqDB search
WRVILNNVIRVNPQNAVSLALMLHRDLGDTPVVDPNEVVDMFVTAQQIQQATEFILEVLR
GKNDESTKDLQTKLLEINLKHSHPSVAEKIFARGVCLYYDGMKLAPLCERAGLPQRAIEC
YVTAQNQDPDLDNLSNIRRCLSHARNFNPEWILEFFGKLSQADSMRCLGDLLQNHRENFK
VIVQVATKYSDALGADKLIELFLEQKLYPILYYYLGAIVPYTRDPEVHFRYIEAAAEVGQ
AQELERMTRESPCYDPERTKNYLKNKKLTNLWPLINVCDQHGYIDELVRYLIDTDNETLI
EQYLQRRSPGKTPEVVAALIDCNAREDFIKNILNAVGTMCPIAELVQAVEERSRLRLIQG
WLEARLAEKKTDPALHNAVGKLYVDTDQQPDKFLLENAYYEPLVLGKYCENRDPNLSYIA
YRKGHLSEELVELTTKNGMWKQLARYLVQEKNLQLWASTLKNDTKDRDRLVEAVQQTALP
ESEVDEEVSTTVRAFMNAGMTHELTSILDQIVVRGR
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
attggcgtgtcattttgaataatgttattcgtgttaatccacagaatgccgtgagcctgg
cactgatgctccatcgtgacttgggtgacaccccagtagtggacccaaatgaagtggtgg
atatgtttgtgacggctcagcagattcagcaggcgacggagtttatccttgaggttttgc
gagggaagaatgacgagtcgacaaaagacctccagacgaaacttttggaaataaatttaa
aacattctcatccttctgtggcggagaagatatttgcgcgtggtgtttgcctctattacg
atggcatgaaacttgctcctctgtgtgaacgagctggacttcctcagcgcgccattgagt
gctacgtcacggcgcagaatcaagaccccgaccttgacaacctctccaacatacgccgtt
gtctctcccatgctcgcaacttcaatccggagtggatattggaattctttggaaaactca
gtcaggccgatagcatgcgatgcctgggggacctcttacagaaccatcgtgagaacttta
aggtgattgtgcaggtggcgacgaagtatagtgatgctcttggagcagacaaacttatcg
agctctttcttgagcaaaaattgtaccccatcctttactattatcttggtgccattgtac
catacacccgcgacccggaggtacacttccgctacattgaggcggcagcagaggtgggtc
aggcacaggaactggagcgcatgacacgcgaaagcccctgctacgatccggagcgcacga
aaaactacttgaaaaacaaaaagttgaccaatctttggccactcatcaatgtatgtgatc
aacatggttacatagatgagctagtgcgatatttgattgatacggacaacgagacgctta
ttgaacaatacttgcagcgtcggagtccggggaagacacctgaggtagtggctgccctca
tcgactgcaatgctcgagaagactttatcaagaatattctcaatgctgtaggaacgatgt
gccccattgcggagttggtgcaagccgtggaagaacgatctcgcctgcgtctgattcaag
gatggctggaggcccgtttggcggagaagaagacggatcccgcccttcacaatgccgtgg
gaaagttgtacgtcgataccgaccaacaacccgataaatttttacttgaaaacgcctact
acgaaccactagtccttggaaagtactgcgagaaccgtgatccgaatctatcctacatcg
cctatcgcaagggccacctcagtgaggaactggtggagctcaccacgaagaatggcatgt
ggaaacaacttgctcgctatcttgtacaggagaagaatcttcaactgtgggcatcaaccc
tgaaaaatgataccaaggatcgtgatcgacttgtggaagcggtgcaacaaaccgccctgc
ctgagtctgaggtagatgaggaggtaagcacaacagttcgggcattcatgaatgcaggga
tgacacatgaattgacgtctatcctggatcaaattgtggtgcggggtcgct

DBGET integrated database retrieval system