KEGG   Trypanosoma cruzi: 503779.40Help
Entry
503779.40         CDS       T01012                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tcr  Trypanosoma cruzi
Brite
Enzymes [BR:tcr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     503779.40
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 239 aa AA seqDB search
MAWTCSALSNASMIQNLERAALLSTPAIIASLQRVDRGWFVPDGMRSSAYRDEPLSIGYG
ATISAPHMHAIMLELLSPFLLGTPGSLPKAVLDIGSGSGYLTAILADICGDGSRVVGVEH
VEELQERSLKVVLQHFPSWVNEGRITFINGDGRDISKLFHPHTTMFDVIHVGAAAASVPK
DYLEAIKPGGCLVIPVGNENEVQHLHLYTKDEKGTITKKTHGGVSFVPLTSLRHQKTRS
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggacgtgctcggcgttatctaatgcttcaatgatccagaatctggaaagggcg
gcgcttctctccacaccggcgatcatcgcgtcacttcaacgagtggatcgcgggtggttt
gtaccggacggtatgcggagctcggcgtacagggacgaaccgttgtccattgggtacggt
gccactataagtgctcctcatatgcacgccattatgcttgaacttctttctccatttttg
ttaggtactcctgggagcttgcccaaggcagttctggacatcggcagcggtagtggttat
ctcacagccatccttgctgacatctgcggggatggatcacgggtagttggtgtggagcac
gtggaagagttacaggaacgttcattgaaggtggttcttcaacactttcctagctgggtg
aatgaaggccgcattaccttcatcaatggtgacggcagagacatatcaaagttatttcat
ccgcatacaaccatgtttgatgtgattcatgtcggtgcagctgccgcatcggttcccaaa
gattacttggaagcaataaaacctggcgggtgccttgtgattcctgttggaaatgaaaat
gaggtgcagcatctgcatctttacacaaaggacgagaagggaaccatcacgaaaaaaact
cacggtggggtaagttttgttccattgacgtcgctgaggcatcaaaaaacccgcagttga

DBGET integrated database retrieval system