KEGG   Trypanosoma cruzi: 503935.20Help
Entry
503935.20         CDS       T01012                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tcr  Trypanosoma cruzi
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tcr01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tcr00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:tcr00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 392 aa AA seqDB search
MLRRFSALGLQPRRWGLQKLSARFCLSINVPTIAESISSGKVVGWTKKVGDAVSEDEVIC
QIESDKLNVDVRAPTNGVITKINFEEGAVVEVGAELSTMKAGEAGGAAAAPAMQPPPPPP
PQQQQQSSPPPPQQKRSVETPAPAPKPPQVVTTATTGSDPRVRNVRISSMRHRIADRLKA
SQNTCAMLTTFNEIDMTPLIEIRNRYKDDFYKKHNVKLGFMSPFVKACAIALQDVPAVNA
SFGTDFIEYHDFVDISIAVSTPRGLVVPVLRDVQKADFAQIERQIADFGARARVNKLTLA
EMTGGTFTISNGGVFGSWMGTPIINPPQSAILGMHATKKKPWVVGNEIKIRDIMAVALTY
DHRLIDGSDAVTFLVKVKNLIEDPARMVLDLA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgtcgcttcagtgctttggggctgcagccccgccggtggggcctgcaaaagctt
tcggctcgcttctgcctcagcattaacgtgccgaccattgcggagtcgatcagctccggc
aaggttgtagggtggaccaagaaagttggcgacgccgtcagcgaggacgaggtgatctgc
cagatcgagtcggacaaactcaacgtcgatgtgcgggcgccgacaaacggcgtcatcacg
aagatcaactttgaagagggggccgtcgtcgaggtgggcgcggagttgtcaacgatgaag
gcaggggaggctggcggagcggcagcggcccccgcgatgcagccaccaccaccaccacca
ccgcagcagcagcagcagtcatcaccaccaccgccgcaacaaaaacggtctgtagaaacc
ccagcaccggcgccaaaacctccgcaagttgtgaccacagcgaccaccggctccgaccca
cgtgtgcgaaatgtgcgcatctcttccatgcgccatcgtatagcggatcgtctgaaggcg
agccagaatacgtgtgcgatgctgacgactttcaacgaaattgatatgactcccctcatt
gagatacgtaaccggtacaaggacgacttttacaagaagcacaatgtaaagctgggattt
atgtcaccttttgtaaaggcctgtgccattgcactgcaggatgtacccgcagtcaatgcc
tcctttggtacggactttattgagtaccacgattttgttgatatcagcattgcggtatca
acaccacgaggacttgttgttcccgttctgcgtgatgtacagaaggccgattttgctcag
attgaaaggcaaattgccgactttggggcgcgggcaagggtaaataagctgacgctggct
gagatgacgggcggtacattcaccatcagtaatggcggcgtttttggctcgtggatgggg
accccaatcatcaacccaccgcagagtgccattctcggcatgcacgcaacgaagaagaag
ccatgggtggtggggaacgagattaaaatacgcgacattatggcggtagcactgacgtac
gaccatcgcctcattgacggcagcgacgcggtgacatttcttgtgaaggtgaagaacctc
attgaggaccccgcccgcatggtgcttgacctcgcgtag

DBGET integrated database retrieval system