KEGG   Trypanosoma cruzi: 504109.90Help
Entry
504109.90         CDS       T01012                                 

Definition
ubiquitin carboxyl-terminal hydrolase (EC:3.4.19.12)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
tcr  Trypanosoma cruzi
Brite
Enzymes [BR:tcr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     504109.90
Peptidases [BR:tcr01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   504109.90
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 236 aa AA seqDB search
MAKKWLPIESNPDVLNTYLRNLGVPNPKVEFCDVYGLDPDLLVFLPRPVRAMILLYPITP
EIDAADAKTVEMQAAEIKAFMAEKDVFFSKQTVENACGTMALLHAVMNNLDSVGDVRKDS
PIDFLRREGLHGNPEERALLIESDPNLDAAHMGASAEGVTKNQPVNANIDLHFTCFVHAK
DQCVELDGRKQSPLLHGACMDNEQFVSVTAEAIQAKISRNKESFRFNIIALVDKSS
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaatggctgccaatcgagagcaaccccgatgtgttgaatacctacctcagg
aaccttggtgttcccaaccccaaggtggagttttgcgatgtttacggcttggaccccgat
cttcttgtgtttttacctcggcccgttcgcgccatgatacttttgtacccaattacacct
gaaatagatgcagcagatgctaaaactgtggaaatgcaggctgctgaaataaaggcattt
atggcggaaaaagacgtatttttctccaaacaaacagttgagaacgcctgtggtaccatg
gctcttcttcatgctgtgatgaataacttggattctgtgggtgatgtcagaaaagacagc
ccgatagacttcttaaggagggagggactccatgggaatccagaggaacgcgcattactt
attgagtccgatcctaatctagatgcggcgcacatgggggcgtcggcagaaggggtcaca
aagaatcagccggtcaatgcaaatatcgaccttcactttacttgctttgtacatgcaaag
gatcaatgtgtggagctggacgggcgtaaacaatcacccttgctccatggtgcttgcatg
gataatgagcagtttgtgagtgttaccgcagaggcgattcaagccaagatttctcggaat
aaggagtcctttcgtttcaatatcattgctcttgtggacaaatccagctaa

DBGET integrated database retrieval system