KEGG   Trypanosoma cruzi: 504131.170Help
Entry
504131.170        CDS       T01012                                 

Definition
ubiquitin hydrolase (EC:3.1.2.15)
Orthology
K01072  
ubiquitin thiolesterase [EC:3.1.2.15]
Organism
tcr  Trypanosoma cruzi
Brite
Enzymes [BR:tcr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     504131.170
Peptidases [BR:tcr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   504131.170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 727 aa AA seqDB search
MEFMNGSNGFVGRDVIFRPIQFERYRKPSVVSYPRHAIVLNPHHTREVAHDGRAKDNADE
ASSNESEQSERSDIDEDDPLHIEEEQMLCRNEQLRQLLHLRWRHVGPAGCGLENMGNTCF
VNSVLQAIAYTPALAQYFAGTFKAPCSHVVGAPYDYAYALGETIRNIHTPSNRARRAALL
VSNLKGLFPHFQLGRQGDAHEFAVQLLHACHRSILFRQIGSRKVSSCIEQTSTLQRVIGG
YLCSVVAWSRQEEIHRLIKAGKIQEAADLKLSSRGSSSDVLVSNTYDPFVTLSVEVVGQT
LDHCLAKLCQEEKLCRHSYVSPRGVAVQATKRFQLHKLPPVLIIHMKRFNCMGGKVTKYI
QYPKKLNLAPFCTDKAMKANAAVRRNAGGDEKDSSCLYELNAICIHEGNLLVYGHYYSVV
RARNGMWLLCNDERVSYCDEERALRQQAYMLFYSRVEPSSLGAKYTQKKETRTPQPLDRR
PVGEAATGRMTTSMLPGSVREGAEEDMGRPLSEEEVRRMMRKKAAAKQPSPDEGKKEEGV
HRGQLNGQREMSSAHASSSSSDEADEHPSLMSGGVLKNVVSSAPVNGKRETSALQNGHLN
SRYCGIVKAIRQRTAPPALVTTATTTTRAQTMDEMTMAKEAKREAIVGGHVMEVLEEMKQ
QSVPITVARPRHAPKFCQRVRDPMWEMEMDRGRVKRVRAKREEHVGENKFQKAEIAFDSR
GRRHRNA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggaattcatgaacggttccaatggatttgtcggccgcgacgtcatttttcgaccgatt
cagtttgagcggtatcgaaagccctccgttgttagctacccgcgacatgcaattgtgtta
aacccccaccacacacgagaggttgcacacgatgggagggcgaaggataacgccgacgag
gcatcgtccaacgagagtgaacagtcagagagaagtgacattgacgaagatgacccgctg
catattgaggaggagcagatgttgtgccgtaatgagcagctgcgtcagttacttcatctg
cgatggcgccatgttgggcccgctggatgcggactagagaacatgggcaacacatgtttt
gtaaacagtgtacttcaggccatagcttatacaccggctctcgcgcagtattttgccggt
acttttaaggctccgtgctcacatgtggtgggtgcgccatacgactatgcatatgcgttg
ggggaaactatacggaatattcacaccccatcgaatcgagcgcgtcgcgcggctcttctt
gtttccaaccttaagggtctatttcctcattttcagcttggccgacagggggatgcacat
gagtttgcagttcaactcctgcatgcttgtcaccgctccattctttttcgtcagattgga
tcacgaaaggtcagttcttgtattgagcagacaagcacgttgcaacgtgttattggtggg
tatctctgctccgtggtcgcttggagtcgacaggaggaaattcatcgcctcataaaagca
ggaaaaattcaagaagcggccgatttgaaattaagcagccgtggttccagcagcgatgtg
ttggtgtcgaatacatatgatccttttgtcaccctcagtgtggaagttgtggggcaaacc
ctggatcactgcctggcaaagctctgtcaggaggaaaagttgtgcaggcattcctacgtc
agcccgcgtggggtggctgtacaggcaacgaaacgttttcagcttcataaacttccaccc
gttcttattattcacatgaaacgttttaactgcatgggagggaaggtcacaaagtacatt
cagtatccaaagaagcttaacttggccccgttttgtactgataaggcgatgaaagcaaat
gcggcagttcgtcgtaatgcgggtggtgatgaaaaggatagctcgtgtctatatgaactc
aacgccatttgcattcatgagggtaacttactcgtttatggccattactatagtgttgtg
cgtgctcgtaacggaatgtggcttttgtgcaatgacgaacgcgtgtcttattgcgatgag
gaacgtgcgcttcggcagcaagcttacatgttattttactctcgggtggaaccgtcttct
ttaggcgcaaagtatacgcaaaagaaagaaacacgtacgccacaaccgttggacagacgt
cctgtgggagaggcggcaacaggaagaatgacgacgtcgatgttgcctgggtctgtgaga
gaaggtgctgaagaggacatgggtcgtccgttgagtgaggaggaagtaagacggatgatg
agaaaaaaggcggccgccaagcaaccgagtccggacgaaggaaagaaggaggaaggtgta
caccgtggacagttgaatgggcagcgggagatgtcctccgctcatgcatcttcttcctct
tctgatgaggcagatgagcatccgtcgcttatgagtggaggcgtgcttaaaaatgttgtc
tcgtcagcaccagtcaatggtaaaagggagaccagtgctttgcagaatggtcatttaaac
tcccggtactgcggtattgtaaaggccattcggcagcggacggcaccgcccgcattggtc
acaacagccacgacaacaacaagagcccagacgatggatgagatgacgatggcgaaagag
gcgaagagggaggcgattgtcgggggccatgttatggaggttttggaggaaatgaagcag
caatctgtacctattactgtcgcccggcctcgacatgcgccaaagttctgccagcgtgtg
cgggatcccatgtgggaaatggaaatggatcgtgggcgtgtgaaacgtgtgcgggcgaag
cgtgaggagcatgtgggtgaaaataagttccagaaggcggagatcgcgtttgacagtcga
ggacgtcgccatcgcaacgcgtga

DBGET integrated database retrieval system