KEGG   Trypanosoma cruzi: 504149.160Help
Entry
504149.160        CDS       T01012                                 

Definition
phosphoinositide-specific phospholipase C
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
tcr  Trypanosoma cruzi
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    504149.160
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    504149.160
Enzymes [BR:tcr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     504149.160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 720 aa AA seqDB search
MGLCTSKCNVEDKMCRYAPAAKRLVDDFFAQDNEFLGDAGAFFACMWGASRDILLCSGDE
ATAFLRRACFSNPKSEEALNLYLSSSNFGRALWDLNRAKFMMIWMKYDADNSGDISLREL
GKLVKGLNFPADLSKQLIAAVKAAGGIVNYAFLEKEYFLLTRLKELEYVFTGVAGPVRET
ITRDEFKSFLRNYQGEELNGERVKEILDYVCCMKTGEVYFTNFLKFLEDNRFCSIVDEEK
VSKVYQDMNQPICNYFINSSHNTYLTGDQLTSNSSADMYRKALLDGCRCVELDCWDGFAG
EPIVYHGHTRTSKISFLSCIKVIKEYAFKASEYPVILSIEVHTSSAQADRMAEIMCDTFG
DMLFQSPWAPAEPTTFLFSPENLKRKILVKSKRVATSSAISDAEITENEEEEENDEEEET
EGEEKELTTSGPNPLYRQFKEEKKKEKKKKIKVALEKLSRVVSIESAGFKGTSDTSYLEK
RQPYQCTSFVESKAKKIAVSNAMEFKLINQHCLSRIYPAGSRVGSSNYNPQLFWNCGCQI
VALNWQSTHTYAWRLNKGFFSDNGNCGYVLKPESVRSSAASRNGSQVRSLNLEIISGFCL
PKPKRSNKGEIVDPFITCFIEGPDGNSDRKTSGTIRNNGFHPVWRGKGLGSEFSWDVKDW
DLSTLVVQVYDEDKKTRDDFLAECILPLRVLKAGIRQIPLHDINGNSIFGSFLTCSLTFS
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgggtctttgtacgagtaagtgtaacgttgaggataagatgtgccgctatgctccagcc
gctaaaagacttgtagatgatttctttgcgcaggataacgaatttttgggtgatgcaggg
gcattttttgcatgcatgtggggagcttcacgtgatatcctactttgcagtggggatgaa
gcaactgcgttccttcgtcgcgcgtgtttttcaaatccaaaatcagaagaggcactaaat
ttgtatctttcttcgagtaattttggtcgcgctttgtgggatttgaatcgtgcaaaattt
atgatgatatggatgaagtacgacgctgataacagtggggatattagtctccgtgagttg
ggcaaacttgtaaaggggttgaattttcctgccgatctttccaagcaacttatagctgcg
gtaaaggctgccggtggaattgtaaattacgcctttttggagaaggaatattttttgctc
acgagactgaaagagcttgaatacgtttttacaggtgttgccggcccagttagggagact
ataacaagagatgagtttaagtcttttcttaggaattatcagggggaggaattgaatggg
gagcgcgtaaaggagattttggattatgtatgttgtatgaaaaccggcgaagtctatttc
accaattttcttaaatttttggaggataatcgtttctgtagcattgtggatgaagaaaaa
gtcagcaaggtataccaagatatgaatcagccaatttgtaattattttatcaattcctct
cacaatacttacttgaccggcgatcaattgaccagcaattcatcggcagacatgtatcga
aaggctcttttggatggatgtcgttgtgtggagttggattgctgggatggctttgccggt
gagccgattgtttaccatggtcacacacggacatcgaagatatcatttctttcctgcatc
aaagtgatcaaggagtatgcctttaaggcttctgagtatccagttattttatccattgag
gttcatacaagttccgctcaagccgatcgaatggcagagattatgtgtgatacatttggg
gatatgctttttcaaagtccgtgggctccagctgagcccacgacatttttgttttcccca
gagaatcttaagagaaaaattcttgtgaagagcaaacgagttgcgacatcgtcggccatc
tctgacgcggagataacggaaaatgaagaagaggaggaaaatgatgaggaagaggagaca
gagggagaggagaaggaattgacaacgtcggggccaaatccattgtacagacagtttaaa
gaggagaaaaagaaggagaagaaaaaaaagataaaggttgctttggaaaaattatcacgc
gttgtttccattgagtcggccggatttaaaggcacttctgatacgtcatatctagaaaaa
agacaaccgtaccagtgtacttcctttgttgaatccaaagcgaaaaaaattgccgtgtcc
aatgcgatggaatttaaattaattaaccaacactgccttagtcgcatataccctgcagga
tcccgtgttggcagcagcaattacaatccccaattgttttggaattgcggctgtcaaatc
gtggcactcaattggcaatcgacccacacatatgcatggaggcttaacaagggatttttc
tctgacaatggaaattgcggttatgttttgaagcctgagagcgtgcgatcaagtgctgct
tcgcgcaacggctcccaggtgcgatcactgaatttggagattatttctggattttgtctc
cccaagccgaaacgttccaacaagggcgaaattgtggaccctttcattacgtgttttatt
gagggcccagacggtaatagtgaccgaaagacatcgggaacaattcgcaacaatgggttc
cacccggtatggcggggcaagggcttgggcagtgagttctcgtgggatgtgaaggactgg
gatctttcaacacttgttgtgcaagtttatgacgaagacaaaaaaactcgcgacgacttt
ctagcagagtgcattttaccgttgcgtgtgttaaaagctggtattcgacaaattccattg
catgatatcaacgggaattccatctttggttcatttctcacatgctcccttactttttct
tga

DBGET integrated database retrieval system