KEGG   Trypanosoma cruzi: 504213.80Help
Entry
504213.80         CDS       T01012                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tcr  Trypanosoma cruzi
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tcr01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:tcr00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:tcr00750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 663 aa AA seqDB search
MFNLCVMGSAPATVKEQVERALLAAYVPARFMLTRLEDVKEREDHGRVMSQSFRLLLEAH
DAPPTNPQEMPYDCRFFWTPESTTDEVVTEVKSLLDGRRFISTRGVVDVSTKFLSVVRDG
LAPNSGLFNLQSIPQMAMSQMRHFFTTSTLSYVEGAQLVLERLVDTTMQPEKLRMLLMEA
YAPCRWSGLSDVCPVTPLLLDETENHKAMDGHHHGANKETGAAADPCWRDMSLMELYHGP
TAAFKDFALQLFPRYFDIAASNECTDTPPSYVILTATSGDTGVAAISGFVNAGSPTRVMV
LYPLHGVSPVQQIQMLSYDNGASVRVYGVKSDFDFCQSTVKQLFAKRSLAQRLWSDKKIR
LSSANSINWGRLVPQVAYYFWAYRQFVQKRRLQFGDPLDVVVPCGNFGNILAAFFAKRMG
LPLGKLVVASNCNDVLFEFVETGHYDIRQRHLVQTASPSIDILKASNVERLLFLISNGDA
AFVAAQMLRLETEKHFTLQGDALNVMQDVFWSARCSEAECAATIKEVYEASAGRLLDPHT
AVAVFVARQFRRFQLEKGLSHRPLVIASTAHWAKFPGSVLRALRGEEMAYGITTSVGGRV
NPVRACRELYDEILAHCPGVTVHPALNAALAAAEANAFSPREVEADVSRVEEELLQFVSV
KSA
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgttcaatctctgtgtgatgggctcggccccagccactgtcaaggaacaggtagagcgc
gccctgttggccgcgtacgttcccgcgcgatttatgttgactcggttagaagatgtaaaa
gaacgagaggatcacggccgtgtaatgtcacaatcgtttcgacttcttctcgaggcacac
gacgctcctcccacgaacccgcaggagatgccatatgactgtcgctttttctggacgcct
gaaagcacaacggacgaagttgttacggaagtgaagtcgctgcttgacggtcgccggttt
atctcaacacgcggcgtggtagacgtgtcaaccaaatttctgagtgttgtgcgggacggt
ctggcaccgaatagcggcctctttaaccttcaaagcatcccacaaatggcaatgtcgcaa
atgcgtcacttttttacgacttccacgctgagttacgttgagggggcacaacttgtgctg
gaacggcttgtggacaccaccatgcagccagaaaaactacgcatgttactcatggaggca
tacgcgccttgtcgctggagcggactgagtgacgtgtgccctgtcacgcctttgctcctc
gatgagactgagaatcataaagccatggatggtcatcatcatggcgctaacaaagaaacg
ggtgcagcagccgatccatgttggcgtgacatgtccctgatggagctctaccatgggcct
acagcagccttcaaggactttgctctgcagctcttcccccgttactttgacattgcagca
tccaacgagtgtaccgacaccccgccctcgtacgtcatactcacggcaacatctggtgat
acgggtgtggctgccatcagcggctttgtgaacgccggaagccccacgcgcgtcatggtg
ttgtaccccctccacggcgtatcccctgtgcaacaaattcaaatgttgtcctacgataat
ggagcatctgtgcgcgtttacggggtgaagtcggactttgatttttgtcagtccaccgtg
aagcaactgttcgccaaacgatcgctggcgcagcgactgtggagcgacaaaaaaatccgg
ctctcttccgccaatagcatcaattggggtcgtctcgtgccgcaagtggcatattacttt
tgggcgtaccgtcaatttgtgcagaagaggcgtctacaatttggcgatcctctagacgtt
gttgtcccgtgtggaaattttggtaacatccttgcggccttctttgcaaagcggatgggg
ctaccgctcggcaagttggtggtggcctcaaactgcaacgatgtgctctttgagtttgta
gagactggccattacgacattcgccagcgacacctggtgcaaacggcatcgccttctatt
gatattttaaaggcctccaacgtggagcggcttctctttttgatctcaaatggagatgcg
gcatttgtggcggcgcaaatgcttcggctggagacggagaagcacttcaccttgcagggg
gacgcactgaatgtcatgcaggacgttttctggtccgcccgctgcagcgaggcggagtgt
gctgcaacgatcaaagaagtgtatgaagcctcagccggccgcctgctggacccacacact
gccgttgctgtctttgtggcgaggcaatttcgtcggttccagctggagaagggtctgtcg
catcgtccgcttgtcatcgcgagcacggcccactgggccaaatttcctggatccgtgctg
cgtgcgctgcgtggtgaagaaatggcgtatggcatcacaacttcggtcggagggcgggtg
aaccccgtgcgtgcctgcagagagttgtatgatgagattcttgcgcattgcccgggcgtc
acagtccaccctgcgctgaacgccgcactggcagcagccgaagcgaatgcgttttcaccc
cgtgaagttgaggcagacgtgtcccgtgttgaagaggagctcctgcagtttgtctccgtg
aagtctgcctga

DBGET integrated database retrieval system