KEGG   Trypanosoma cruzi: 504427.110Help
Entry
504427.110        CDS       T01012                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tcr  Trypanosoma cruzi
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tcr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tcr00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tcr00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tcr00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 677 aa AA seqDB search
MENLTVEEARHRHDKDVVQPYKANSARSYVGKSISDRQALYAESKKDPVLFWSKIAADNF
YWKNLWPSEKPAMEFNFHKSKGKVFVKWFDGARTNICYNALDRHLTQHKDRVCYYWEGNA
EGETSSVTYGNMHEAVLQLAAVLRHQYGVRKGQVVTLYLPMIPFTVQLMLAVARIGAVVS
VVFAGFSGKALASRIIDSASELVITADSSFRGEKPIPLKEVVDVAIAECESEGHHIQCLV
YERHGRENIPMKSGRDRWYGDVVAAMTASQLADCPIEWVGAEDPLFMLYTSGSTGKPKAI
LHTVGGYMVFAGTTFKYSFDYHEEDVYFCTADIGWVTGHSYVVYGPMLNAATSVLFEGTP
TYPTPSRWWELVDKYGVTVFYTAPTAIRSLMQYDDEPVKRTSRATLRVLGSVGEPINVEA
WRWYYGVVGEGHVDISDTWWQTETGGHLITPLPGCTPLKPGSATLPFFGIEPALLDPITN
AEIDGPGEGLLVIKSPWPGQARTIFGDSERYEQMYFSVDGYYMTGDGARRDEDGYYWITG
RVDDVLNVSGHRIGTSEVEDAVNTHPLVVESAVVGIPHDTKGEGIYVYVTFHQNTIIDKD
LLNAVRATVRKVIGPLATPDHIHPAQCGLPKTRSGKILRRILRKIAAGIFDGLGDISTLA
DQTIVAKLIEGRNGVSI
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacctcacagtagaggaggcccgtcatcggcacgataaagacgttgttcagcct
tataaggcaaatagtgctagatcgtatgtaggaaaatccatttccgatcgccaggccctg
tacgccgaatccaagaaggatcccgttcttttctggagcaagattgcagcagataacttt
tactggaaaaatttatggccctcagaaaagccggcgatggagttcaatttccacaagagt
aaaggaaaagtctttgtgaagtggtttgatggagcaaggactaacatttgctacaatgct
cttgaccgccaccttacacagcacaaagaccgcgtgtgttactactgggaaggaaacgca
gagggggaaaccagctcggtgacgtacggcaatatgcatgaggctgttctgcagctggca
gccgtgttacggcaccagtatggcgtccggaagggccaggtggtcactctgtacctccca
atgatcccattcactgtgcagctcatgctggcagtagcccgcatcggagccgtggtctcc
gttgtatttgccggcttctctggaaaagcgcttgcctctcgcatcattgactccgccagc
gaacttgtcattacggctgactcttcttttcgtggagagaagcccattcctcttaaggag
gttgtggatgtggccattgcggaatgtgagagcgaaggtcatcatatccaatgcctcgtg
tatgagcgacacggtcgggagaatattccaatgaagtcaggccgtgatcggtggtatggc
gatgtggttgccgccatgacagccagccagctggcggattgtcccatagagtgggtgggc
gcagaagacccactctttatgttgtacacctccggcagcaccggtaagccaaaagcaatt
cttcacaccgttggaggatacatggtgtttgcgggaaccactttcaagtacagctttgac
taccacgaggaagacgtgtacttctgcaccgcggacattggttgggtcacaggccattcg
tatgtggtgtatggtcccatgctaaacgccgccacgtccgtgctttttgagggcacacca
acatatcccacaccctcccgttggtgggagcttgtggataagtatggtgtcacggttttt
tacaccgcaccaacagctattcgatcgctcatgcaatatgacgatgaacccgtaaagagg
acgagtcgagcgacactccgcgttcttggtagcgtcggggagccaatcaacgtggaggct
tggaggtggtattatggggtagtcggcgaaggccacgtggacatcagcgacacgtggtgg
caaacagagacgggcgggcacctcattacaccgctgccgggctgcacgccgctgaagcct
ggaagtgcaacgctgccgttctttggtatcgagcctgccctgttggacccaattacaaat
gcggaaattgacggtcccggtgaagggctccttgtgatcaagagcccgtggccggggcag
gcccgcactatctttggggattctgagcgctacgagcagatgtacttctccgtagacggg
tattacatgacaggagacggtgcacgccgcgacgaggacggctattactggattaccggc
cgcgtggacgacgtgttgaacgtcagtggccaccgcatcggcaccagcgaggtggaggac
gccgtaaacacgcacccccttgttgtggaaagcgccgttgttggcatcccgcatgatacg
aagggggagggcatttatgtctatgtcacatttcaccagaacaccataatcgacaaggat
ctcctcaatgccgtcagggctactgtccgtaaagtgattgggccgctggcaacacccgat
cacatccacccggcgcagtgtggacttccgaagacgcggtctggtaagattctgcgtcgc
atcttgcgcaaaattgccgccggtatttttgacggccttggcgacatcagcaccctcgcg
gatcaaacaattgtggcgaaacttatcgagggaaggaatggagtctctatttga

DBGET integrated database retrieval system