KEGG   Trypanosoma cruzi: 504427.110Help
Entry
504427.110        CDS       T01012                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tcr  Trypanosoma cruzi
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    504427.110
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    504427.110
   00620 Pyruvate metabolism
    504427.110
   00640 Propanoate metabolism
    504427.110
Enzymes [BR:tcr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     504427.110
Lipid biosynthesis proteins [BR:tcr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   504427.110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 677 aa AA seqDB search
MENLTVEEARHRHDKDVVQPYKANSARSYVGKSISDRQALYAESKKDPVLFWSKIAADNF
YWKNLWPSEKPAMEFNFHKSKGKVFVKWFDGARTNICYNALDRHLTQHKDRVCYYWEGNA
EGETSSVTYGNMHEAVLQLAAVLRHQYGVRKGQVVTLYLPMIPFTVQLMLAVARIGAVVS
VVFAGFSGKALASRIIDSASELVITADSSFRGEKPIPLKEVVDVAIAECESEGHHIQCLV
YERHGRENIPMKSGRDRWYGDVVAAMTASQLADCPIEWVGAEDPLFMLYTSGSTGKPKAI
LHTVGGYMVFAGTTFKYSFDYHEEDVYFCTADIGWVTGHSYVVYGPMLNAATSVLFEGTP
TYPTPSRWWELVDKYGVTVFYTAPTAIRSLMQYDDEPVKRTSRATLRVLGSVGEPINVEA
WRWYYGVVGEGHVDISDTWWQTETGGHLITPLPGCTPLKPGSATLPFFGIEPALLDPITN
AEIDGPGEGLLVIKSPWPGQARTIFGDSERYEQMYFSVDGYYMTGDGARRDEDGYYWITG
RVDDVLNVSGHRIGTSEVEDAVNTHPLVVESAVVGIPHDTKGEGIYVYVTFHQNTIIDKD
LLNAVRATVRKVIGPLATPDHIHPAQCGLPKTRSGKILRRILRKIAAGIFDGLGDISTLA
DQTIVAKLIEGRNGVSI
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacctcacagtagaggaggcccgtcatcggcacgataaagacgttgttcagcct
tataaggcaaatagtgctagatcgtatgtaggaaaatccatttccgatcgccaggccctg
tacgccgaatccaagaaggatcccgttcttttctggagcaagattgcagcagataacttt
tactggaaaaatttatggccctcagaaaagccggcgatggagttcaatttccacaagagt
aaaggaaaagtctttgtgaagtggtttgatggagcaaggactaacatttgctacaatgct
cttgaccgccaccttacacagcacaaagaccgcgtgtgttactactgggaaggaaacgca
gagggggaaaccagctcggtgacgtacggcaatatgcatgaggctgttctgcagctggca
gccgtgttacggcaccagtatggcgtccggaagggccaggtggtcactctgtacctccca
atgatcccattcactgtgcagctcatgctggcagtagcccgcatcggagccgtggtctcc
gttgtatttgccggcttctctggaaaagcgcttgcctctcgcatcattgactccgccagc
gaacttgtcattacggctgactcttcttttcgtggagagaagcccattcctcttaaggag
gttgtggatgtggccattgcggaatgtgagagcgaaggtcatcatatccaatgcctcgtg
tatgagcgacacggtcgggagaatattccaatgaagtcaggccgtgatcggtggtatggc
gatgtggttgccgccatgacagccagccagctggcggattgtcccatagagtgggtgggc
gcagaagacccactctttatgttgtacacctccggcagcaccggtaagccaaaagcaatt
cttcacaccgttggaggatacatggtgtttgcgggaaccactttcaagtacagctttgac
taccacgaggaagacgtgtacttctgcaccgcggacattggttgggtcacaggccattcg
tatgtggtgtatggtcccatgctaaacgccgccacgtccgtgctttttgagggcacacca
acatatcccacaccctcccgttggtgggagcttgtggataagtatggtgtcacggttttt
tacaccgcaccaacagctattcgatcgctcatgcaatatgacgatgaacccgtaaagagg
acgagtcgagcgacactccgcgttcttggtagcgtcggggagccaatcaacgtggaggct
tggaggtggtattatggggtagtcggcgaaggccacgtggacatcagcgacacgtggtgg
caaacagagacgggcgggcacctcattacaccgctgccgggctgcacgccgctgaagcct
ggaagtgcaacgctgccgttctttggtatcgagcctgccctgttggacccaattacaaat
gcggaaattgacggtcccggtgaagggctccttgtgatcaagagcccgtggccggggcag
gcccgcactatctttggggattctgagcgctacgagcagatgtacttctccgtagacggg
tattacatgacaggagacggtgcacgccgcgacgaggacggctattactggattaccggc
cgcgtggacgacgtgttgaacgtcagtggccaccgcatcggcaccagcgaggtggaggac
gccgtaaacacgcacccccttgttgtggaaagcgccgttgttggcatcccgcatgatacg
aagggggagggcatttatgtctatgtcacatttcaccagaacaccataatcgacaaggat
ctcctcaatgccgtcagggctactgtccgtaaagtgattgggccgctggcaacacccgat
cacatccacccggcgcagtgtggacttccgaagacgcggtctggtaagattctgcgtcgc
atcttgcgcaaaattgccgccggtatttttgacggccttggcgacatcagcaccctcgcg
gatcaaacaattgtggcgaaacttatcgagggaaggaatggagtctctatttga

DBGET integrated database retrieval system