KEGG   Trypanosoma cruzi: 504443.10Help
Entry
504443.10         CDS       T01012                                 

Definition
ubiquitin hydrolase (EC:3.1.2.15)
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
tcr  Trypanosoma cruzi
Brite
Enzymes [BR:tcr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     504443.10
Peptidases [BR:tcr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   504443.10
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 464 aa AA seqDB search
MATVKVKWGKELLELTVSLQSTVGAFKEKLQQLTQVPAERQKIMGLKANASKDDATLSQV
GVTDGKTLMLLGAAAEPPQTKEPPPSPAAASNTTAVQAPAAATRTPTGLRNIANTCYMNA
AVQMLHLVPELIELLQSRKNDTLLHSMGELYKTMEANKDPVTPLLFWNALIMQNSTFGEV
DEHGHPMQHDAQEVLNTILQQLNNGIQETHKNLFSGTMKRTSVCKEIPDDVSEASDLPFL
MLSCNINAEVQMLETGLYASFNETIPVRSEKLAREVLYSRTSRISILPEYLFVHLVRFSW
RADTQKKAKILKPVSFPLVLDTFTLCTDALKESMQEERGRVLARRDKELERRRQARQKTQ
FDVTTNAEEVSTGAMAGDAHNIGNKSGYYELCGVISHKGRSAESGHYVFWGKPEDQWFVY
DDEHVASVTEEDVKRLSGVGEAHIAYVLMYRSRDPRTKATTIPL
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggtaaaggtaaagtggggcaaggagcttcttgagcttacggtcagtcttcag
agcacggtgggggcattcaaggaaaagctgcagcagctgacacaggttcctgcggaacgg
caaaaaattatgggcctcaaagccaatgcatccaaggacgacgctacgctctcccaagtt
ggtgtcactgacggcaaaacgctgatgcttcttggagcggcagcggaaccgccacaaacc
aaagaaccaccgccgtcgccagccgccgcatccaacacgacagcggtccaagctcccgct
gcagccacgagaacgcctacaggattgagaaacattgcaaatacatgttacatgaatgcg
gcagttcaaatgcttcatcttgtgcctgagttgattgagttgctccagtcacgtaaaaat
gacacgttgcttcattcaatgggcgagctgtacaagacgatggaagccaataaagaccct
gtcaccccgttgctcttttggaatgccctgatcatgcaaaattccacctttggggaggtt
gacgaacatggccatccgatgcagcacgacgcgcaggaagttctcaacacaattcttcag
caacttaacaatgggattcaagaaacacacaaaaatctttttagtgggacgatgaaacgg
acttccgtctgcaaagaaatccccgatgacgtgtccgaggcgtctgacttgccattcctc
atgttatcttgcaatatcaatgcagaggtacagatgctggagactggattgtatgcatcc
tttaatgagacaatccccgtccgttcggaaaagttggcacgcgaagtactttactcacgc
acaagccgaatcagcattttgccggagtatctttttgtgcatcttgtgcgtttttcatgg
agggcagatactcaaaagaaggccaaaatactcaagccagtctccttccccctggtacta
gatacctttactctctgtacggatgcactaaaggaaagcatgcaggaggaacgaggcagg
gtgttggctcggcgagacaaggagcttgagcgacgtcgtcaagcccgacaaaagacacaa
tttgacgttaccacaaacgcagaagaggtgtcaactggggcgatggcaggtgacgcacat
aacattggcaataagagcggttattatgaactttgtggtgttatttcccacaagggccgg
agtgcagagagtgggcactacgtcttctggggtaagcctgaggatcagtggtttgtctac
gatgatgagcacgtggcctccgtgacagaggaagacgtcaagcgtctgagtggcgttggt
gaggcgcacattgcgtatgttcttatgtaccgttctagggacccacgtacaaaggccacg
acgattccactttga

DBGET integrated database retrieval system