KEGG   Trypanosoma cruzi: 506007.40Help
Entry
506007.40         CDS       T01012                                 

Definition
protein kinase
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
tcr  Trypanosoma cruzi
Brite
Enzymes [BR:tcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     506007.40
Protein kinases [BR:tcr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   506007.40
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 453 aa AA seqDB search
MSSEIEPHILRKYEIQAQLGQGAYGIVWRASDRRTHQVVALKKIYDAFQNATDAQRTFRE
IMFLQALSHPNIIKLLHVHRATNDKDIYLVFEYMETDLHVVIRANILEDIHKQFIIYQLL
KTLKYLHSAELLHRDMKPSNLLVNSDCSMKVADFGLARSILSLEKEQVARPALTDYIMTR
WYRPPEILLGSTRYTKGVDMWAVGCILAELLLGRPIFPGRTTIKQLELIINVLGEPTPED
IASTNSQFAEAMMKDIRRTHTATFAELLPKASPDALDLVQKLMRFNPNERLTAEQALEHP
YVAAFHKVQDEPSAPAPVTISLPDDTRFTMQEYRERLYQEIANARRRVRREAAAALSSKN
ESGGVVTRAHPPPSAAAPVAEERREKVRDAAVTHTSSSTAARPNSSTATRTALANGASRT
TLASRTSDATRPAHHTRPVVSRHGLNGSRTMQK
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctgaaatagaaccgcatattctccgcaaatatgagattcaggcgcagttagga
cagggggcgtacggcatcgtttggcgtgcgtccgaccgccgcacccatcaggtagtcgcc
ctaaagaaaatatacgatgcgtttcaaaacgcaaccgacgcacagcgcacatttcgtgag
attatgtttttgcaggcccttagccacccgaacataataaaactgctgcatgttcaccgt
gccactaacgataaagatatttaccttgtctttgagtatatggagacagacctgcatgtt
gttatccgtgccaacattcttgaggatatccacaaacagtttattatttatcaactactg
aaaacgttgaagtacctccattctgcggagttgctacaccgcgatatgaagccatcaaat
cttttggtcaacagcgactgctcaatgaaggttgcggattttggattagcgcggtcaatt
ctctctctggagaaggaacaagtggctcgccccgccctcacggattacatcatgacccgt
tggtatcgaccgccagagatcctactgggctcgacacgctatacaaagggggtggacatg
tgggctgtaggatgtattcttgctgagctccttcttggaagacccatattccctgggcgt
acaacaataaagcagctggagcttatcatcaatgttcttggcgaaccgacaccagaggat
attgcgtcgacaaactcccagtttgcggaggcgatgatgaaggacattcgacgcacacat
acggcgacttttgcggagttgcttcctaaagcctcgccggacgcacttgacttggtgcaa
aaacttatgcgattcaaccccaatgagcgcctcaccgcagagcaggcgttggagcatcca
tatgtggctgcttttcacaaggtgcaggacgagccctcggcacctgcgccagtaaccatc
tcgcttccagatgacacacgctttaccatgcaggaataccgtgagcgtctctaccaggag
attgcaaacgcaagaagaagagtccgccgagaggcggccgcagccttatcttcaaagaac
gagtctggcggcgtggtgactcgggcgcatccgcccccctccgctgcggcccccgtggcg
gaagagagacgggaaaaagtccgtgacgcggcagtcacacacacatcgtcttcgactgct
gctcggcccaattcttcgaccgcaacacgtacggcgttggcgaatggggccagtcgaacg
actcttgcaagtagaacttccgacgcgacgcggcctgcgcatcatactcggcctgttgtt
tcacgtcatgggcttaatggttcacgaaccatgcaaaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system