KEGG   Trypanosoma cruzi: 506025.60Help
Entry
506025.60         CDS       T01012                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tcr  Trypanosoma cruzi
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    506025.60
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    506025.60
  Amino acid metabolism
   00310 Lysine degradation
    506025.60
Enzymes [BR:tcr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     506025.60
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 404 aa AA seqDB search
MLRRFSALGLQPRRWGLQKLSARFCLSINVPTIAESISSGKVVGWTKKVGDAVSEDEVIC
QIESDKLNVDVRAPANGVITKINFEEGAVVEVGAELSTMKAGEAGGAAAAKEQAAAPAMQ
PPPPPPPQQQQQQQQQQQSSPPPPQQKRSVETPAPAPKPPQVVTTTTTGSDPRVRNVRIS
SMRHRIADRLKASQNTCAMLTTFNEIDMTPLIEMRNRYKDDFYKKHNVKLGFMSPFVKAC
AIALQDVPAVNASFGTDFIEYHDFVDISIAVSTPRGLVVPVLRDVQKADFAQIERQIADF
GARARVNKLTLAEMTGGTFTISNGGVFGSWMGTPIINPPQSAILGMHATKKKPWVVGNEI
KIRDIMAVALTYDHRLIDGSDAVTFLVKVKNLIEDPARMVLDLA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgtcgcttcagtgctttggggctgcagccccgccggtggggcctgcaaaagctt
tcggctcgcttctgcctcagcattaacgtgccgaccattgcggagtcgatcagctccggc
aaggttgtagggtggaccaagaaagttggcgacgccgtcagcgaggacgaggtgatctgc
cagatcgagtcggacaaactcaacgtcgatgtgcgggcgccggcaaacggcgtcatcacg
aagatcaactttgaagagggggccgtcgtcgaggtgggcgcggagttgtcaacgatgaag
gcaggggaggctggcggagcggcagcggcgaaggagcaggcagcggcccccgcgatgcaa
ccaccaccaccaccaccaccacagcagcagcagcagcagcagcagcagcagcagtcatca
ccaccaccgccgcaacaaaaacggtctgtagaaaccccagcaccggcgccaaaacctccg
caagttgtgaccacaacgaccaccggctccgacccacgtgtgcgaaatgtgcgcatctct
tccatgcgccatcgtatagcggatcgtctgaaggcgagccagaatacgtgtgcgatgctg
acgactttcaacgaaattgatatgactcccctcattgagatgcgtaaccggtacaaggac
gacttttacaagaagcacaatgtaaagctgggatttatgtcaccttttgtaaaggcctgt
gccattgcactgcaggatgtacccgcagtcaatgcctcctttggtacggacttcattgag
taccacgattttgttgatatcagcattgcggtatcaacaccacgagggcttgttgttccc
gttctgcgtgatgtacagaaggccgattttgctcagattgaaaggcaaattgccgacttc
ggggcgcgggcaagggtgaataagctgacgctggctgagatgacgggcggtacattcacc
atcagtaatggcggcgtttttggctcgtggatggggaccccaatcatcaacccaccgcag
agtgccattctcggcatgcacgcaacgaagaagaagccatgggtggtgggaaatgagatt
aaaatacgcgacattatggcggtagcactgacgtacgaccatcgcctcattgacggcagc
gacgcggtgacatttcttgtgaaggtgaagaacctcattgaggaccccgcccgcatggtg
cttgacctcgcgtag

DBGET integrated database retrieval system