KEGG   Trypanosoma cruzi: 506127.170Help
Entry
506127.170        CDS       T01012                                 

Definition
eukaryotic translation initiation factor eIF-4E
Orthology
K03259  
translation initiation factor 4E
Organism
tcr  Trypanosoma cruzi
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    506127.170
Translation factors [BR:tcr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    506127.170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 261 aa AA seqDB search
MSDVKSKEAGANPAASKSGAGEDVAETKLAVPRSLDTGSKKHPLNSSWTLWYDSLSTYDS
ERWELSLVEVITVRTVEEFFTMLHYCKPPHVLRVSAQYHFFREGVKPMWEDPSNKAGGKL
WISLDDKPVGDVGGRKWENANTSGAAGGEKDNASAATNNSNSNQNAKAKKEEQETEKKPE
LDTMWENLLMAMVGEYLDPEPDGDHIMGLVLSRRKYHNRIALWLRDASASEAVARIEKKL
VKEAGLPPAMKFIFTPHSTGK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgtgaagtcgaaggaggcgggtgcaaatcctgctgcttccaagagcggtgct
ggcgaagatgttgcggagacgaaattggctgttcctcgcagcttggacacgggatcaaag
aagcacccgctgaactcctcgtggacgttgtggtacgactctctttccacatacgacagt
gagcggtgggagttgtctcttgtggaggtgatcacggtccgtacagtggaggagttcttt
acgatgttgcattattgcaagccaccccatgtacttcgtgtttcggcccaatatcacttt
ttccgcgagggtgtgaaaccgatgtgggaggatccgagcaacaaagccggtggaaaactg
tggataagcctggatgataagcctgttggcgatgtcggaggaaggaaatgggaaaatgcc
aacacgagtggtgccgcaggtggggagaaagacaatgcaagcgccgccacgaacaacagc
aatagcaatcaaaatgccaaagccaagaaggaagaacaagagacagagaagaaaccggag
ttggacaccatgtgggaaaatttgctcatggctatggtgggagagtaccttgacccggag
ccggacggcgatcacatcatggggttggtcttgtcaaggcgcaagtatcataaccgcatc
gccctttggctgcgtgacgcctccgccagcgaggctgttgctaggattgagaagaaactc
gtgaaagaggctggcctgccgccggcaatgaagtttatcttcaccccccacagcaccggg
aagtag

DBGET integrated database retrieval system