KEGG   Trypanosoma cruzi: 506167.50Help
Entry
506167.50         CDS       T01012                                 

Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
tcr  Trypanosoma cruzi
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    506167.50
Exosome [BR:tcr04147]
 Exosomal proteins
  Proteins found in most exosomes
   506167.50
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 1704 aa AA seqDB search
MNGPLTTAEVFQLNSVAGGLRPGTISFKTLTLESDKYVCLRDVQPDGQTSLVIVDLEKRE
SMRNNIRDAESAIMNPKSKILALRSGRNLQVFDVVAAKRLKVVLFSEDVVFWRWVDDRTI
GLVSGTAVYHWSLDSAEDAAPERVFERAPDMGASVQILNYCTDEKKKWLLLSGVARVAEG
MVGKTQLYSVENRDGRVVDGHAGTFISTNTPTEPRACNIMCLAWNTPHEGGKVQLMELPT
SPKMDITMPRRVVDVAFPPGDFPVALTVSPRHKLLTIMTSRGTAILMDIFTGTIIQSQQV
TPNIVFCGTLYTKTGGLLCVNNQGSVFHVSPNDNGIIPFVKDQMRNPELAVRIASSANLG
GVDDLYRMQLENGLRVGNIEEAIRACLRAPNNALRVPEVLQRFVHHPSAPGQPPAISTYF
KMVLAETTLNAHESVELARAVVPKGGSAYIKQQYEANKLTPSEELADLLAQAEPEMAMKM
YYKAEAHAKVVNILLQRNETQKAVEYCRRSNFSPDWRVILNNFIRVNPQNAVSLALMLHR
DLGDTPVVDPNEVVDMFVTAQQIQQATEFILEVLRGKNDESTKDLQTKLLEINLKHSHPS
VAEKIFARGVCLYYDGMKLAPLCERAGLPQRAIECYVTAQNQDPDLDNLSNIRRCLSHAR
SFNPEWILEFFGKLSQADSMRCLGDLLQNHRENFKVIVQVATKYSDALGADKLIELFLEQ
KLYPILYYYLGAIVPYTRDPEVHFRYIEAAAEVGQAQELERMTRESPCYDPERTKNYLKN
KKLTNLWPLINVCDQHGYIDELVRYLIDTDNETLIEQYLQRRSPGKTPEVVAALIDCNAR
EDFIKNILNAVGTMCPIAELVQAVEERSRLRLIQGWLEARLAEKKTDPALHNAVGKLYVD
TDQQPDKFLLENAYYEPLVLGKYCENRDPNLSYIAYRKGHLSEELVELTTKNGMWKQLAR
YLVQEKNLQLWASTLKNDTKDRDRLVEAVQQTALPESEVDEEVSTTVRAFMNAGMTHELT
SILDQIVVRGRFRKNRFLENLLIMTAIRSRKEKVMEYVSTLENYDAKEVASIASNAELPE
VAFAVYEKNDMKKEAATVLLRDLKDISRGRSYAQKCDIPAVWSVLGEYLLAADEVHEAIE
SFIRAKDPDFLEEVTAAAERNNQFGDLIKYLTMARKESRAKDNKIDTALVLTYAKTGRLM
ELEEFLKETHNVQIQPVADKCFDEGLYDSARVLYTLASNFSKLAVTLLRMNNLPAAVEAA
QKAQSRKTWTAVNIACIEANEIKLANICAVPLVLEAEMLQSVMDRYESYGLWEELLSLLK
TASSTPGAHMGVFTGMGLLLAKYRPEKLLEHVNMHAKKINTHKMIAACEEYHLWLVLRVL
HVNNEDWLAAATTMMRHHVDAWDHDVFKTVVSHLGSSDLVYNSIPFYIQNNPQLLDDFLT
SMFKTLDPERVLLEVKKLAPVHFIRQYLESAQERNSRRVNEAINKLYMEEEDFTALRDSV
ERFDNFDSAELSAELEKMELFEFRKIALFLHRRNKRFTHAIAVAKENKLYQDAIETAAES
ANPQIVEDLLDFFVVDHPECFVACLYTCYDYLTPQVVMEKAWLNKRTDLAMPYFIQVIQE
YTTKLSRMEKSMMDAQQLAKEAARRAGPLHTGANDPLMIQAGPANPMGGAMPMPMPMPMP
MPMMGGVPPGNYGPPPQFDNRRPY
NT seq 5115 nt NT seq  +upstreamnt  +downstreamnt
atgaacggccccttgacgacagctgaggttttccagttgaattctgtcgccggtggtctg
cggcccgggacaatctccttcaagacattgacattggagagcgacaagtatgtctgcctc
cgcgatgtgcagccggatgggcagacgtcacttgtcattgtggacttggagaaacgtgag
agtatgcggaacaacattcgcgatgcggagtcggccataatgaaccccaagtcaaagatc
cttgcgcttcgcagtggtcgtaatttgcaagtctttgacgtggttgccgcgaagaggctt
aaggtggttttgttttccgaggatgtggttttttggcgctgggtcgatgatcgaacaatt
gggttggtgtccggcactgcggtgtaccactggagcctggactctgcggaggatgccgcg
ccggagcgtgtctttgagcgcgccccggacatgggcgcatcggtacagatactgaactac
tgcactgacgagaagaagaagtggttgttgttgtcgggtgtggcgcgagtggcagaggga
atggtgggaaagacacaactgtacagcgtggagaatcgtgatggtcgcgttgttgatggc
cacgcggggacattcatctcgacaaatacacccaccgagccccgtgcatgcaacatcatg
tgcctggcgtggaacaccccgcacgaaggtggcaaagtgcagttgatggaacttcccacg
agccccaagatggatatcacaatgccccgccgggtggtggatgtcgcattcccacctggc
gactttccagtcgccctgaccgtttccccccggcacaagttgctgacaatcatgacaagc
cgtggaaccgccatcttgatggatatatttaccggcaccatcattcaatctcaacaggtg
acacccaatatcgttttctgtgggaccttgtacacaaaaacgggtggactgctttgtgtc
aacaaccaaggttccgtttttcatgtttccccaaatgacaatggaatcattccatttgta
aaggatcaaatgagaaacccggagcttgccgtacgtatcgccagctctgctaacttggga
ggcgttgatgatctctatcgcatgcaattggagaacggtcttcgtgtagggaatattgaa
gaagccattcgtgcctgtctacgggctcctaacaacgccttgcgtgtaccagaagtcctc
caacgatttgtgcaccatccatcagcccctggacaaccaccagccatatcgacatacttt
aagatggttcttgcggagacgacactgaatgcgcatgaatctgttgaacttgcacgtgca
gttgtgccgaaaggtgggtctgcctacataaagcagcaatacgaggccaataaactaacg
cccagcgaagagcttgccgatcttttggcacaggccgaaccagaaatggcgatgaagatg
tattacaaggctgaggcccatgcaaaggtggtgaatatacttttgcaacgcaatgagaca
caaaaagcggtggaatattgcagacggtcaaatttctcaccggattggcgtgtcattttg
aataattttattcgtgttaatccacagaatgccgtgagcctggcactgatgctccatcgt
gacttgggtgacaccccagtagtggacccaaatgaagtggtggatatgtttgtgacggct
cagcagattcagcaggcgacggagtttattcttgaggtcttgcgagggaagaatgacgag
tcgacaaaagacctccagacgaaacttttggaaataaatttaaaacattcccatccttct
gtggcggagaagatatttgcgcgtggtgtttgcctctattacgatggcatgaagcttgct
cctctgtgtgaacgagctggacttcctcagcgcgccattgagtgctacgtcacggcgcag
aatcaagaccccgaccttgacaacctctcgaacatacgccgttgtctctcccatgctcgc
agctttaatccggagtggatattggaattctttggaaaactcagtcaggccgatagcatg
cgatgcctgggggacctcttgcagaaccatcgtgagaactttaaggtgattgtgcaggtg
gcgacgaagtacagtgatgctcttggagcggacaaacttatcgagctctttcttgagcaa
aaattgtaccccatcctgtactattatcttggtgccattgtaccatacacccgcgacccg
gaggtgcacttccgctacattgaggcggcagcagaggtgggtcaggcacaagaactggag
cgcatgacacgcgaaagcccctgctacgatccggagcgcacgaaaaactacttgaaaaac
aaaaagttgaccaatctttggccactcatcaatgtatgtgatcaacatggctacatagat
gagctagtgcggtatttgattgatacggacaacgagacgcttattgaacaatacttgcag
cgtcggagtccgggaaagacacctgaggtagtggctgccctcatcgactgcaatgctcga
gaagactttatcaagaatattctcaatgctgtaggaacgatgtgccccattgcggagttg
gtgcaagccgtggaagaacgatctcgcctgcgtctgattcaagggtggctggaggcccgt
ttggcggaaaagaagacggatcccgcccttcacaatgccgtgggaaagttgtacgtcgat
accgaccaacaacctgataaatttttacttgaaaacgcctactacgaaccactagtcctt
ggaaagtactgcgagaaccgtgatccgaatctgtcctacatcgcctatcgcaagggccac
ctcagtgaggagctggtggagctcaccacgaagaatggcatgtggaaacaacttgctcgc
tatcttgtacaggagaagaatcttcaactgtgggcatcaaccctgaaaaatgataccaag
gatcgtgatcgacttgtggaagcggtgcaacaaaccgccctgcctgagtctgaggtagat
gaggaggtaagcacaacagttcgggcattcatgaatgcagggatgacacatgaattgacg
tctatcctggatcaaattgtggtgcggggtcgctttaggaaaaatcggtttttggagaat
cttttgatcatgaccgccatccgttctcgcaaggaaaaggtgatggaatatgtgtcaaca
ttggagaattacgacgccaaggaggttgccagcatcgccagcaacgcagagttgcctgaa
gtggcctttgcggtttacgaaaagaacgacatgaaaaaggaggccgctacggtgctgttg
cgggatttgaaggatatttcgcgtggtcgttcctacgcccaaaagtgtgatatacccgct
gtttggtcagtccttggggagtatttgcttgccgcagacgaggtgcatgaggcgattgaa
tcatttattcgagcaaaggatccagactttttggaagaagttacggcggcggcggagagg
aacaatcagtttggtgatcttatcaaatacctcaccatggcacgcaaagaatcccgtgca
aaggacaacaaaattgatacggcgttggtgcttacatatgccaagaccggtcgtctgatg
gagttggaagagttcctaaaagagacccacaatgtgcaaatccaacctgtggcagataag
tgcttcgacgaaggattgtatgactccgcgcgggtgctgtacacgctggcttccaatttt
tccaaactagcggtgacactgttgaggatgaataatctaccagcggctgtggaggctgcg
caaaaggcacagtcaagaaagacatggacagctgttaatattgcctgtattgaggccaat
gagattaaactggccaacatatgtgccgttccacttgtactagaagccgaaatgttgcaa
agtgtcatggatcgctatgaaagttatggactttgggaagaattgctctccctgcttaag
acagcatcctccacaccaggggcccatatgggtgtttttactggaatgggacttctgttg
gcgaaatacaggcctgaaaaactattagaacatgtgaatatgcacgccaagaagatcaat
acacataaaatgattgctgcatgtgaggagtatcatctgtggttggtgcttcgagtttta
catgtcaacaacgaggattggcttgctgccgccacgacgatgatgcgccaccacgtcgat
gcctgggatcatgacgttttcaagactgttgtgagtcatttgggatccagcgatttggtg
tacaactccatcccattctacatccaaaacaatccacaactccttgacgactttctcacc
agtatgtttaagacgttggaccccgagcgtgtcttgctggaggtgaagaagctcgcccct
gtgcactttattcgtcagtatctggagtctgcccaggaacgcaactccagacgtgtgaat
gaggcaattaacaagctatatatggaggaagaggacttcactgctttgcgtgactctgtg
gagcgctttgacaactttgactccgcagaattaagtgctgagcttgaaaagatggagctt
tttgagttccgcaagattgcgctttttctccatcgccgtaacaagcgatttacacatgcc
attgccgtggcgaaggagaacaaactctaccaggatgccattgaaactgccgccgagagt
gccaacccgcagattgtagaggatcttctggacttttttgttgtggatcacccggagtgc
tttgttgcgtgtctttacacatgctacgactacctcacaccacaggtcgtgatggaaaag
gcatggctcaacaagcgtacggacctcgccatgccgtactttattcaggtcattcaagaa
tacacaacaaagttatcgcgcatggagaagtccatgatggacgcccaacaattggcaaag
gaggcggcgaggcgggcggggccgctgcatacgggtgcaaatgaccctctgatgattcaa
gcagggccagcaaacccaatgggcggcgcgatgccaatgccaatgccaatgccaatgccg
atgccaatgatgggtggtgtgccgccaggcaattacggtcccccgccgcagtttgacaac
aggaggccgtactag

DBGET integrated database retrieval system