KEGG   Trypanosoma cruzi: 506247.410Help
Entry
506247.410        CDS       T01012                                 

Definition
(RefSeq) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tcr  Trypanosoma cruzi
Brite
Enzymes [BR:tcr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     506247.410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 Methyltransf_32 RrnaAD Methyltransf_11 Methyltransf_23 Methyltransf_24 MTS
Motif
Other DBs
NCBI-GeneID: 3552968
NCBI-ProteinID: XP_820355
GeneDB: Tc00.1047053506247.410
UniProt: Q4E113
AA seq 239 aa AA seqDB search
MAWTCSALSNASMIQNLERAALLSTPAIIASLQRVDRGWFVPDGMRSSAYRDEPLSLGHG
ATISAPHMHAIMLELLSPFLLSTPGSLPKAVLDIGSGSGYLTAILADICGDGSRVVGVEH
VVELQERSLKVVLQHFPSWVNEGRITFINGDGRDISKLFHPHTAMFDVIHVGAAAASVPK
DYLEAIKPGGCLVIPVGKENEVQHLHLYTKDEKGTITKKTHGGVSFVPLTSLRHQKNRS
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggacgtgctcggcgttatctaatgcttcaatgatccagaatctggaaagggcg
gcgcttctgtccacaccggcgatcatcgcgtcacttcaacgagtggatcgcgggtggttt
gtaccggacggtatgcggagctcggcgtacagggacgagccgttatcccttgggcacggt
gccactataagtgctcctcatatgcacgcgattatgcttgaacttctctctccatttttg
ttaagtactcctgggagcttgcccaaggcagttctggacatcggcagcggtagtggttat
ctcacagccatccttgctgacatctgcggggatggatcacgggtagtcggtgtggagcac
gtggtagagttacaggaacgttcattgaaggtggttcttcaacactttcctagctgggtg
aatgaaggccgcattacctttatcaatggtgacggcagagacatatcaaagttatttcat
ccgcatacagccatgtttgatgtgattcatgtcggtgcggctgccgcatcggttcccaaa
gattacttggaagcaataaaacctggcgggtgccttgtgattcctgttggaaaggaaaat
gaagtgcagcacctgcatctttacacaaaggacgagaagggaaccatcaccaaaaaaact
cacggtggggtaagttttgttccattgacgtcgctgaggcatcaaaaaaaccgcagttga

DBGET integrated database retrieval system