KEGG   Trypanosoma cruzi: 506359.60Help
Entry
506359.60         CDS       T01012                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase 2 (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tcr  Trypanosoma cruzi
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    506359.60
   00052 Galactose metabolism
    506359.60
   00500 Starch and sucrose metabolism
    506359.60
   00520 Amino sugar and nucleotide sugar metabolism
    506359.60
Enzymes [BR:tcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     506359.60
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 482 aa AA seqDB search
MSSVTAAISEAASACRAKMEAAGVNEACIRTFLKQHAFISKGETGNIPESSISPVESLDS
LEDLTVPADPSLLEHLVVLKLNGGLGTGMGLQTAKTLLPVKDGKTFIDFTVLQLEHLRKT
YSDHLRFMLMDSFATSSETKAHIKKYSWLFDTFDKEVELIQNRVPKICQDTLLPVTYEAD
ASCEWAPPGHGDLYTALYGSGKLDDLLRSGYKYMFVSNGDNLGATLDARLLAYMKLNQLE
FLMEVCRRTESDKKGGHIAYQTACFDDDTAPERRFILRESAQCPKEDEASFQDVERHRFF
NTNNLWVDLAALKKTMDSHSGALPLPVIRNAKTVNPVDGTSTKVYQLETAMGAAIGLFRR
SAAVVVPRERFAPVKTCSDLLALRSDAYVVTEDQRLVLCEERAGKPPTIELDNQHYKIIT
GLDALVKDGVPSLRQCTKLIIQGPVEFQSGTVVKGEVVIRNSKKEPFIIERDRVLNNEVM
EV
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctgtgactgcggcgatctcagaggctgcttctgcctgcagggcaaagatggag
gcggcaggggtgaacgaggcgtgcattcgcacatttttgaagcagcacgccttcatcagc
aaaggagaaacaggcaacattcccgagagcagcatatctcccgtagagtctctcgactca
cttgaagacctcaccgtgccggcggacccttctctactggagcacctggtggtactgaaa
ctcaatggcggtcttggcacgggcatgggactacagacggcaaaaactcttcttcccgtc
aaggatggcaaaacgttcattgattttactgtgctgcaactggaacatcttcgcaagacg
tacagtgaccatctacgttttatgctgatggactcctttgccacctcttctgagacgaaa
gcccatataaaaaaatactcatggttatttgacacctttgacaaggaggtggagttgatt
cagaaccgtgtaccaaaaatttgccaggacactcttcttcccgttacgtatgaggcagat
gcctcgtgcgagtgggcgcctccgggacatggggacctttacacggcactctatggtagc
ggtaagctggatgatctgcttcgcagtgggtataaatatatgtttgtatcaaacggtgac
aacttgggggcaacgctggatgcccgtcttctcgcatatatgaaattaaaccagttggag
ttccttatggaggtttgcaggcggactgaatctgataaaaagggtggtcatattgcctat
caaactgcttgttttgacgatgacacagcgcccgagcgtcggtttatacttcgtgagtcg
gcgcagtgcccaaaggaagatgaggcgagttttcaggacgttgagaggcatcgttttttt
aacacgaacaatttgtgggtggatcttgcggccctcaagaagacgatggacagccacagc
ggggcactgccactgcctgtgattcgaaacgcaaaaacagtgaacccggtagatggcacc
tcaacaaaggtgtatcaactggagacggcaatgggcgcggccattgggctctttaggcgc
tctgcagcagtggtagttccacgagagcgttttgcccctgtaaagacgtgctcggattta
cttgcgctacgatccgatgcgtatgtcgtgacggaagatcagcgtcttgttctctgtgag
gagcgggccggaaagccaccgacgattgaacttgataaccaacactataagattatcact
ggtctggatgcgctggtgaaggatggtgtgccatcgctacgacaatgcactaaactcatc
attcagggtccagtggagttccagagtggcacagtggtgaagggtgaggtggtgatacgc
aacagtaagaaggagcctttcattattgaacgcgaccgagtgctgaataatgaagtgatg
gaggtttag

DBGET integrated database retrieval system