KEGG   Trypanosoma cruzi: 506401.50Help
Entry
506401.50         CDS       T01012                                 

Definition
malonyl-CoA decarboxylase, mitochondrial precursor (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
tcr  Trypanosoma cruzi
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tcr00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:tcr00410]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:tcr04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 717 aa AA seqDB search
MPFQRHIIRRGSCRSGPLSLCSHVGWAFQHPRRLYGTQPTPWQSEDRVSNWCCRLWGLRE
GCWGDSPSLPSPASMPSWTSPHSGLGRELLSEVECQIKLAEELKAVMIGEKGRLPESLVE
SVWDIYESIIPPDVATDIARYVTPTQEIKFFEFIGLLAELDINLADVKAATEKLTRCVGV
IETLHADVKRGEERDGEQDNGASSSELASDAAMLSAKLVTAKNELLRQCVAVSQAGSPVH
YLWLRQSASLERGMRRLMDLRRCVTYFKSRCRERLAALQTDGKQEGQQLSAPVTVAARRE
NMDLWIARQRHVSSIDGALEFLFSDFFAKEWLVMEELTWHSTPPLLLEKVIAAEAVHPFF
SGLVDMKQRLQPTKNRHLFAFFHPAVVEEPLIAVQVALTRGIAGSVDRILGRPSPLDNPQ
RELGDACTYDTRGCNDGSCSDGVDTAIFYSINSANSALRGFNLGNLLIKRVVREIEARLN
AERRAEGLSLITTFSTLSPIPGYIPWLTTQVAKLQQDVLECRDGSSAGGLKFLNHRIFGD
SKDDEACLFSQLREAVLQFVSRHPDIHADLAAHLLSKCSNGATGVANLFTMQFLLRLFQM
PDVDTNSHHHHHVWWEDSDLTRAIELPLLRSVAHYLYKEKRRGRILDQVGNFHISNGATM
WRLNYLGNCSVAGSRESATVMVNYLYDPARVSEQVNAYEVQRTVSVGEKVLQHLGTI
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgccttttcaacgtcacattatacggagagggagctgcaggagtgggcctctctctctc
tgctctcatgtggggtgggcatttcaacatccgcggcggctttatgggacgcaaccaacg
ccgtggcaatcggaggatcgcgtgtcaaattggtgttgtaggctctggggtcttcgagag
ggctgctggggcgattctccctcacttccatcaccggcttcgatgccatcgtggacatcg
ccccatagcggcctcggtcgggagctgttgagcgaggtcgagtgccaaataaagcttgcg
gaggagttgaaggctgtgatgattggggaaaagggacggttgccagagtcccttgtggaa
tcggtgtgggacatatacgagtccattattccgcccgatgtggcaacggacattgcccga
tatgtaacacctacgcaagaaattaagttttttgagtttatagggcttttggcagaactt
gacattaatctcgcggacgtcaaggcggcgacggagaaattgacccgatgcgtcggtgtc
attgagacgctccatgcggatgtgaagcggggcgaagagagggatggggaacaggacaat
ggcgccagcagtagcgagcttgcgtcggatgccgcaatgctatcggcaaaactagtcacg
gcaaagaacgagttgcttcggcagtgtgtcgctgtaagtcaggcgggatctccggtacat
tacctctggttgagacagagtgcgtcgttagaacgtggaatgaggcggcttatggacttg
cgtcgttgtgtcacctatttcaaaagtcgatgtcgtgagcgtcttgcggcgcttcagact
gatggaaagcaagagggccagcagctctccgcaccagtgactgtagccgcgaggagggaa
aatatggatctatggatcgcgcgacagcgtcatgtgtcttcgatagatggtgcgttagag
tttttgtttagtgatttctttgcgaaggagtggcttgtgatggaggagctaacgtggcac
tcgaccccgccgttgttactcgaaaaggtgattgctgcagaggctgtgcatccctttttt
agtggccttgtcgacatgaagcagcgattgcagccgaccaagaatcgtcatctttttgcc
tttttccatcctgctgtggtggaggagccgttaatcgccgttcaggtagccttaacgcgc
gggatcgccggctcagtggatcgcattcttggacgaccatcgcccctcgacaatccgcaa
cgagaattaggagatgcatgcacttatgacactcgtggttgtaatgatggcagctgtagt
gatggggtggacacggccatattctacagcatcaactccgctaattctgcactgcggggc
tttaatcttggcaatttgcttatcaagcgcgtggtgcgggagattgaggcgagactcaat
gcggagcggcgtgcggagggtttatctttgatcacaacgttttccacgctctcgcctatt
cccggctacattccgtggctgaccacacaggtggccaaactgcagcaggacgttcttgaa
tgccgtgacggttcctcggcggggggcttgaaatttttaaatcaccgcatctttggtgat
tcaaaagatgatgaggcgtgcttgttttcacagcttcgcgaggccgtgctacaatttgtg
agtcgtcatccggatatccacgcagatcttgccgcacatcttctttctaagtgctcgaat
ggcgcaacaggagtggcaaacttgtttaccatgcagtttttgctccgcctgtttcaaatg
cctgacgttgacacaaatagccatcatcatcatcatgtgtggtgggaggacagtgacctt
acacgtgccattgagttgccgttattgcgttctgtggcccattatctctacaaggagaag
cgacgaggtcgcattcttgaccaagttggaaattttcacatttccaacggggcaacaatg
tggcgactaaattacttgggcaactgtagcgtcgctggcagccgtgagagtgctacagtg
atggtgaactacctctacgacccagcacgagtgagtgagcaggtgaatgcatatgaggtt
caacgtaccgtgtctgttggggagaaggtcctgcaacaccttggcacaatatga

DBGET integrated database retrieval system