KEGG   Trypanosoma cruzi: 506401.50Help
Entry
506401.50         CDS       T01012                                 

Definition
malonyl-CoA decarboxylase, mitochondrial precursor (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
tcr  Trypanosoma cruzi
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    506401.50
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    506401.50
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    506401.50
Enzymes [BR:tcr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     506401.50
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 717 aa AA seqDB search
MPFQRHIIRRGSCRSGPLSLCSHVGWAFQHPRRLYGTQPTPWQSEDRVSNWCCRLWGLRE
GCWGDSPSLPSPASMPSWTSPHSGLGRELLSEVECQIKLAEELKAVMIGEKGRLPESLVE
SVWDIYESIIPPDVATDIARYVTPTQEIKFFEFIGLLAELDINLADVKAATEKLTRCVGV
IETLHADVKRGEERDGEQDNGASSSELASDAAMLSAKLVTAKNELLRQCVAVSQAGSPVH
YLWLRQSASLERGMRRLMDLRRCVTYFKSRCRERLAALQTDGKQEGQQLSAPVTVAARRE
NMDLWIARQRHVSSIDGALEFLFSDFFAKEWLVMEELTWHSTPPLLLEKVIAAEAVHPFF
SGLVDMKQRLQPTKNRHLFAFFHPAVVEEPLIAVQVALTRGIAGSVDRILGRPSPLDNPQ
RELGDACTYDTRGCNDGSCSDGVDTAIFYSINSANSALRGFNLGNLLIKRVVREIEARLN
AERRAEGLSLITTFSTLSPIPGYIPWLTTQVAKLQQDVLECRDGSSAGGLKFLNHRIFGD
SKDDEACLFSQLREAVLQFVSRHPDIHADLAAHLLSKCSNGATGVANLFTMQFLLRLFQM
PDVDTNSHHHHHVWWEDSDLTRAIELPLLRSVAHYLYKEKRRGRILDQVGNFHISNGATM
WRLNYLGNCSVAGSRESATVMVNYLYDPARVSEQVNAYEVQRTVSVGEKVLQHLGTI
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgccttttcaacgtcacattatacggagagggagctgcaggagtgggcctctctctctc
tgctctcatgtggggtgggcatttcaacatccgcggcggctttatgggacgcaaccaacg
ccgtggcaatcggaggatcgcgtgtcaaattggtgttgtaggctctggggtcttcgagag
ggctgctggggcgattctccctcacttccatcaccggcttcgatgccatcgtggacatcg
ccccatagcggcctcggtcgggagctgttgagcgaggtcgagtgccaaataaagcttgcg
gaggagttgaaggctgtgatgattggggaaaagggacggttgccagagtcccttgtggaa
tcggtgtgggacatatacgagtccattattccgcccgatgtggcaacggacattgcccga
tatgtaacacctacgcaagaaattaagttttttgagtttatagggcttttggcagaactt
gacattaatctcgcggacgtcaaggcggcgacggagaaattgacccgatgcgtcggtgtc
attgagacgctccatgcggatgtgaagcggggcgaagagagggatggggaacaggacaat
ggcgccagcagtagcgagcttgcgtcggatgccgcaatgctatcggcaaaactagtcacg
gcaaagaacgagttgcttcggcagtgtgtcgctgtaagtcaggcgggatctccggtacat
tacctctggttgagacagagtgcgtcgttagaacgtggaatgaggcggcttatggacttg
cgtcgttgtgtcacctatttcaaaagtcgatgtcgtgagcgtcttgcggcgcttcagact
gatggaaagcaagagggccagcagctctccgcaccagtgactgtagccgcgaggagggaa
aatatggatctatggatcgcgcgacagcgtcatgtgtcttcgatagatggtgcgttagag
tttttgtttagtgatttctttgcgaaggagtggcttgtgatggaggagctaacgtggcac
tcgaccccgccgttgttactcgaaaaggtgattgctgcagaggctgtgcatccctttttt
agtggccttgtcgacatgaagcagcgattgcagccgaccaagaatcgtcatctttttgcc
tttttccatcctgctgtggtggaggagccgttaatcgccgttcaggtagccttaacgcgc
gggatcgccggctcagtggatcgcattcttggacgaccatcgcccctcgacaatccgcaa
cgagaattaggagatgcatgcacttatgacactcgtggttgtaatgatggcagctgtagt
gatggggtggacacggccatattctacagcatcaactccgctaattctgcactgcggggc
tttaatcttggcaatttgcttatcaagcgcgtggtgcgggagattgaggcgagactcaat
gcggagcggcgtgcggagggtttatctttgatcacaacgttttccacgctctcgcctatt
cccggctacattccgtggctgaccacacaggtggccaaactgcagcaggacgttcttgaa
tgccgtgacggttcctcggcggggggcttgaaatttttaaatcaccgcatctttggtgat
tcaaaagatgatgaggcgtgcttgttttcacagcttcgcgaggccgtgctacaatttgtg
agtcgtcatccggatatccacgcagatcttgccgcacatcttctttctaagtgctcgaat
ggcgcaacaggagtggcaaacttgtttaccatgcagtttttgctccgcctgtttcaaatg
cctgacgttgacacaaatagccatcatcatcatcatgtgtggtgggaggacagtgacctt
acacgtgccattgagttgccgttattgcgttctgtggcccattatctctacaaggagaag
cgacgaggtcgcattcttgaccaagttggaaattttcacatttccaacggggcaacaatg
tggcgactaaattacttgggcaactgtagcgtcgctggcagccgtgagagtgctacagtg
atggtgaactacctctacgacccagcacgagtgagtgagcaggtgaatgcatatgaggtt
caacgtaccgtgtctgttggggagaaggtcctgcaacaccttggcacaatatga

DBGET integrated database retrieval system