KEGG   Trypanosoma cruzi: 506559.200Help
Entry
506559.200        CDS       T01012                                 

Definition
thioredoxin
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
tcr  Trypanosoma cruzi
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    506559.200
Enzymes [BR:tcr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     506559.200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 441 aa AA seqDB search
MKPLNSRRRTLKSKCPLAAIFLSIPLFFMVLLLTSIVFAEAFPFTKFSGVVELTPATFKN
FVSSHKPVYILFYAPWCGHCRRIHPEWEKFAQSAYGTVRVGAINADEHSQIAGQFGIRGF
PTIKYWNVGEKDINKPQEYNGPRQAKSLQANAMNQITSSGIKTITSSDALREAVQKAPEK
KIVVLFSSKPRIPAIFAVLSHSPRLKSMPFYFVGENAKKEVSEEFGVQERPSIAVLNATE
GDIKTVIYPGKQIAYEPIAKFLLACATDDADNLDAAKENAGEHPQENDSGKGKNTAAAGG
GTPTPALPVRPVRLTAQLLADFCLPATLRVHERAPLCVLSFTSAFTLERVHEMFHNEPLL
FFEADAERDVILSALRNDLGLEEVANSVEGGASHQMLLLRAAKRDTIRYKLLDGIETVDG
ANEVLQRVLSGDLQLGKKVLQ
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgttgaattcaagacgtcggacgctgaaatctaaatgccctttggcggccatt
tttctttcgataccgcttttttttatggtattacttttaacgagcattgtttttgcggag
gcatttccgtttacgaaattctctggcgttgtggaactaacgcctgcaacctttaagaat
tttgtgtcttcccacaagccagtgtacattcttttttatgccccgtggtgcggtcactgc
cgcagaattcacccagagtgggagaaatttgctcagtctgcctacggcaccgtccgcgtg
ggtgccatcaacgccgacgaacactcgcagattgcagggcagtttggcattcgtggtttt
ccgaccataaagtactggaacgtgggtgaaaaggacatcaacaagccacaggaatacaat
gggccgcgacaggcgaagtcacttcaagccaacgcgatgaatcaaatcacttcctctggg
ataaagacaattacgagcagtgatgccttgcgggaggcagtacaaaaggcacctgagaag
aaaattgtggttctcttctcttccaagccacgtattcccgccatttttgctgttttgtca
cattccccacgtttgaagtctatgccgttttattttgttggtgaaaatgcgaaaaaagaa
gtctcggaggaatttggagtgcaggaacgcccgagcatcgctgttctcaacgccacggag
ggcgacatcaagactgtaatatacccgggaaaacagatcgcctatgagcccattgcgaag
ttcttgttggcatgcgcaacagatgatgccgataatttggatgccgcgaaggaaaatgca
ggagagcatccacaagaaaacgacagtggcaagggcaagaataccgctgcggctggtggt
gggacacccacgccagcattacccgtgcgccccgtacgactaaccgcacagttgttggcg
gacttctgcttaccggcgacactgcgcgtacatgaacgagcaccgctgtgtgtgttgtcg
tttacgtccgcgtttactcttgagcgtgttcacgagatgtttcacaacgaacccctttta
ttcttcgaggcagatgccgagcgtgatgtcattctttctgcccttcggaatgatcttggt
ctggaagaggtggccaacagtgttgagggtggtgcctctcatcagatgctattgttacgg
gcagcgaagcgtgacacgatccgctacaagcttcttgacgggatagagacagttgatggc
gcaaatgaagtactgcagagggtgctttcgggagatttgcagctcgggaaaaaagtgctg
cagtga

DBGET integrated database retrieval system